Entry information : HaPrxII02 (HanXRQChr12g0355041)
Entry ID 10994
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2016-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrxII02 (HanXRQChr12g0355041)
Name (synonym) HaPrxII02 (HanXRQChr12g0355041)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type Embryos
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrxII02
start..stop
S start..stop
HaPrxII05 308 1e-109 1..162 1..162
VvPrxII03 285 7e-101 1..162 1..162
CsPrxII02 279 2e-98 1..162 1..162
CclPrxII02 279 3e-98 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2221396..2221550 155 N° 2 2222390..2222469 80 N° 3 2222561..2222814 254  
join(2221396..2221550,2222390..2222469,2222561..2222814)


exon

Literature and cross-references HaPrxII02 (HanXRQChr12g0355041)
DNA ref. HanXRQ genome:   HanXRQChr12 (2221396..2222814)
EST ref. GenBank:   CD850913.1
Cluster/Prediction ref. HanXRQ:   HanXRQChr12g0355041
Protein sequence: HaPrxII02 (HanXRQChr12g0355041)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17271.03  
PI (pH):   %s   5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIKVGDTIPDGTLAYFDENDELQQVSVHTLAAGKKVVIFGVPGAFTPTCSMKHVPGFIEKSEELKAKGVEDLLLIVNDPFVMKAWKKSYPETKNVKFLADGSATYTHALGLELDLAEKGLGVRSRRFALLVDNLKVVVANVESGGEFTVSSADDILAAL

Retrieve as FASTA  
Remarks Complete sequence from EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATCAAAGTTGGTGACACAATTCCCGACGGAACCCTTGCTTATTTCGACGAGAATGATGAGTTGCAACAGGTTTCTGTTCACACTCTCGCCGCCGGCAAGAAAGTCGTCATC
TTTGGTGTCCCTGGTGCCTTCACTCCCACTTGCAG
GTTTTATAAAAGCTCTAATTTTTATAAATTTTGTTGCTTTTCGAGGTGTTTGAGTTCTTGATTGTTGGAAATTGGAGTATTGTTA
GGTTTTATGTGCTGTTAATTGATGTTAATTGGGAAAATTTTGAATTGATTTTAGGATTTAGGGTTTTAAGGTTTTGAATTTTAGGGGTTTGGTTATTGAAACCCTAAATTTTATAAATTA
TGTTGCTTTTTGAGGTGTTGAGTTTTTGATTGTTGGAAATTGGAATGTTGTTAGGTTTTATGTGCTGTTAATTGATGTTAATTGGGGAAATTTTGAATTGATTTTAAGATTTAGGGTTTT
AAGGTTTTGAATTTTAGGGGTTTGGTTATTGAAACCCTAATTTTTATAAATTATGTTGGAAATTGGAAGGTTGTTAGGGGTTTTATGTGTACATGTGTTGTTAATTGATGATATTTGGGG
AAGTTATGAAATGATTTTGGGTTTTAGGGATTTGGTTATTAAAACCCTAATGATAGTGTGTGTGTGTGTGTGTGTGTGTTTCTTGATCTAGGGTGTTTGAATGTATGTTTTTGGATTGTT
TGGTTTGATATGAAGAATTGGAAGCAAATGATAAGAGGTTGAATTTCGGTTACAATAATTAGGGTTTTCTATTCAGAAGGGAATGACGGCGCAGTTTGTTGCTCGTCTGCTTGTAATTTA
ATTCACATACACGCTTTCTCGATGCAAAAAAAAAAAAAAATCACAAATTTTAAATAATTAGTTTACTTGCAGACATCACTTTTCCTTTTGAATGTCAAATTGTTTTTTTTTTTTAAATTG
TAACAAATTCTTGTCGATAATTCGTGTGGCGTAGTATGAAGCATGTCCCAGGCTTCATTGAGAAATCTGAAGAGCTTAAAGCAAAGGGTGTGGAGGACCTTTTGTTGATTAGTGGTAAGT
GTTTGTATAAACAAGAAATTTAATTGTGTCATTGTGCTAATTTAATGAAAAAAAAACAAATCTTTTTTTTTTTTTAAATGTGCAGTGAATGATCCGTTTGTGATGAAGGCGTGGAAGAAA
TCGTACCCAGAGACCAAGAACGTGAAATTCTTAGCCGATGGGTCTGCAACCTACACCCATGCACTTGGGCTGGAGCTTGACCTTGCTGAGAAAGGGCTCGGGGTCAGGTCAAGGCGGTTT
GCTCTGTTGGTTGACAACCTGAAGGTGGTGGTTGCTAACGTTGAATCAGGCGGCGAGTTCACTGTTTCCAGTGCAGATGATATCTTGGCGGCTTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATCAAAGTTGGTGACACAATTCCCGACGGAACCCTTGCTTATTTCGACGAGAATGATGAGTTGCAACAGGTTTCTGTTCACACTCTCGCCGCCGGCAAGAAAGTCGTCATC
TTTGGTGTCCCTGGTGCCTTCACTCCCACTTGCAG
TATGAAGCATGTCCCAGGCTTCATTGAGAAATCTGAAGAGCTTAAAGCAAAGGGTGTGGAGGACCTTTTGTTGATTAGTGTGAAT
GATCCGTTTGTGATGAAGGCGTGGAAGAAATCGTACCCAGAGACCAAGAACGTGAAATTCTTAGCCGATGGGTCTGCAACCTACACCCATGCACTTGGGCTGGAGCTTGACCTTGCTGAG
AAAGGGCTCGGGGTCAGGTCAAGGCGGTTTGCTCTGTTGGTTGACAACCTGAAGGTGGTGGTTGCTAACGTTGAATCAGGCGGCGAGTTCACTGTTTCCAGTGCAGATGATATCTTGGCG
GCTTTGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCACAAAAA AATAAACAAC TGAACCACTT ACCACCCACA ACCAATTCGT CACTAAAAAT GGCTCCGATC AAAGTTGGTG ACACAATTCC CGACGGAACC CTTGCTTATT TCGACGAGAA  TGATGAGTTG CAACAGGTTT CTGTTCACAC TCTCGCCGCC GGCAAGAAAG TCGTCATCTT TGGTGTCCCT GGTGCCTTCA CTCCCACTTG CAGTATGAAG CATGTCCCAG GCTTCATTGA  GAAATCTGAA GAGCTTAAAG CAAAGGGTGT GGAGGACCTT TTGTTGATTA GTGTGAATGA TCCGTTTGTG ATGAAGGCGT GGAAGAAATC GTACCCAGAG ACCAAGAACG TGAAATTCTT  AGCCGATGGG TCTGCAACCT ACACCCATGC ACTTGGGCTG GAGCTTGACC TTGCTGAGAA AGGGCTCGGG GTCAGGTCAA GGCGGTTTGC TCTGTTGGTT GACAACCTGA AGGTGGTGGT  TGCTAACGTT GAATCAGGCG GCGAGTTCAC TGTTTCCAGT GCAGATGATA TCTTGGCGGC TTTGTGAACT TCTTTATAGT GTTTCAAACC TTTTCTTTTG ATGCAGCCTT TTTTTTTGTA 
TTTGAAACTG AATTCTGCTT TTTATTAAGA TACAATAATT AAGGTTTGCG CTTAAAGCTG TGTTTTCTG 

Retrieve as FASTA