Entry information : EglPrx176
Entry ID 10995
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-05-15 (Qiang Li)
Peroxidase information: EglPrx176
Name EglPrx176
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx176
start..stop
S start..stop
EcamPrx176 461 6e-166 38..269 70..301
EgrPrx176 459 7e-166 38..269 58..289
EcamPrx58 407 1e-144 38..269 70..304
MePrx88 366 2e-128 38..269 64..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..120 120 N° 2 165..356 192 N° 3 971..1136 166 N° 4 1242..1644 403
join(1..120,165..356,971..1136,1242..1644)


exon

Literature and cross-references EglPrx176
Protein sequence: EglPrx176
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271
PWM (Da):   %s   29665.87  
PI (pH):   %s   6.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRLNQELIFFRRIISLFHMVAQGKKSMLTCIIVEGEFCVGCDGSVLLDSTANNKAEKVAVPNQSLTGFDVIDEIKEKLEETCPGVVSCADILALAARDSVSFQFKKSMWEVLTGRRDGRISRESEALSNIPSPFFNFTTLKQSFANKSLTLHDLVVLSGGHTIGVGHCNFFSNRLYNFTGKGDQDPSLDPTTPLNxKAQCKTLSDNATTVAMDPGSPLSFDSHYYKAVNRKQGLFQSDAALLTNLESRKIVNELLDQDGFFTEFGQSMIN

Retrieve as FASTA  
Remarks Partial sequence from NGS. 5' and PS are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGATTGAACCAAGAACTGATATTCTTTAGAAGAATCATTTCATTGTTCCATATGGTCGCACAAGGTAAAAAATCGATGCTTACGTGCATCATTGTAGAAGGAGAGTTTTGCGTG
GTAATATTTCTTTGGTGCTTGATCGCATCGTTTCATGTGTGTAGGGTTGCGATGGCTCAGTTTTGCTAGACTCGACGGCGAACAACAAGGCGGAGAAGGTGGCGGTTCCGAACCAGTCGC
TAACTGGGTTCGACGTAATAGACGAGATCAAGGAGAAGCTGGAGGAAACATGCCCTGGGGTCGTCTCTTGTGCCGACATCCTGGCTTTAGCTGCTAGAGACTCGGTCTCTTTCCAA
GTAA
GACTTTTCGGGGTGATGAAAAACTCTAGGGCCATTCATTGGCATTCTCTTGGGTTTGTTTTGAAAACTTTTCTTCATGAGTTAGTAGAATTTTAATAACCTCATCAACACTCCATGACAC
GTGCTCTTGAAAAAAACTATTGTGGAAAAAGCTTTTTTAACCATACGATGGCGACACTAGATTATCAAGTAAAAGCTCATCCGTCTTCTACTGATACTATTCTCGACCCTACACATACAT
CGGCCCTAATTATCTTTTGATTTGTGATCAATCCAAAGAAAAATATTCACCGGTCCTAATCATTATCCAATTGAACGATATTGCTTCTACAAAAGTGTCCCGACACTTTACTATGAAAAA
GTTCAATAAGGTCGATCGATTTGAGAAACAAACGTACCTCTTTTTCTTTTTGTTTTTTCCCAAATTAAAGTTTTCTCTTGTTTCTGGTTGTTGAAAATTCCCACTAATAATGTGCATTAT
ATTATGATTTACATTAATTTGAAGTTTTAGTGGATCTCACATGATTGCAACAATTAATTGTGATTTGCAGTTCAAAAAGTCGATGTGGGAGGTGTTGACTGGAAGAAGAGATGGGAGAAT
TTCACGTGAATCAGAAGCGCTTTCCAATATCCCTTCCCCATTCTTCAACTTTACAACTCTCAAGCAATCTTTTGCCAACAAGAGCCTCACTCTTCACGACCTTGTTGTCTTATCAGGTAA
ATCAAATATAAAAGAAATTTCACATTTTATAGGGTCAAAATTAGCCATTAAGAAGC
AAAGTTGAATGAATAATTAAGTACACGACATGTCTGGGTCATCAGGTGGGCACACGATTGGGGT
CGGGCACTGCAACTTCTTCAGCAACAGGCTCTACAACTTCACCGGAAAAGGCGACCAAGACCCGTCCCTCGACCCGACTACGCCTCTCAACTGNAAGGCTCAATGCAAGACGCTCTCCGA
TAACGCCACCACTGTCGCGATGGACCCCGGAAGCCCCCTCTCCTTCGACAGCCACTACTACAAGGCCGTGAACCGAAAGCAGGGCCTCTTCCAGTCCGACGCCGCGCTCCTGACCAACTT
GGAGTCGAGGAAGATCGTCAACGAGTTGCTGGACCAGGATGGCTTCTTCACCGAGTTCGGCCAGTCGATGATTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGATTGAACCAAGAACTGATATTCTTTAGAAGAATCATTTCATTGTTCCATATGGTCGCACAAGGTAAAAAATCGATGCTTACGTGCATCATTGTAGAAGGAGAGTTTTGCGTG
GGTTGCGATGGCTCAGTTTTGCTAGACTCGACGGCGAACAACAAGGCGGAGAAGGTGGCGGTTCCGAACCAGTCGCTAACTGGGTTCGACGTAATAGACGAGATCAAGGAGAAGCTGGAG
GAAACATGCCCTGGGGTCGTCTCTTGTGCCGACATCCTGGCTTTAGCTGCTAGAGACTCGGTCTCTTTCCAA
TCAGAAGCGCTTTCCAATATCCCTTCCCCATTCTTCAACTTTACAACT
CTCAAGCAATCTTTTGCCAACAAGAGCCTCACTCTTCACGACCTTGTTGTCTTATCAGGTAAATCAAATATAAAAGAAATTTCACATTTTATAGGGTCAAAATTAGCCATTAAGAAGC
CC
GGAAAAGGCGACCAAGACCCGTCCCTCGACCCGACTACGCCTCTCAACTGNAAGGCTCAATGCAAGACGCTCTCCGATAACGCCACCACTGTCGCGATGGACCCCGGAAGCCCCCTCTCC
TTCGACAGCCACTACTACAAGGCCGTGAACCGAAAGCAGGGCCTCTTCCAGTCCGACGCCGCGCTCCTGACCAACTTGGAGTCGAGGAAGATCGTCAACGAGTTGCTGGACCAGGATGGC
TTCTTCACCGAGTTCGGCCAGTCGATGATTAATTAG

Retrieve as FASTA