Entry information : EglPrx179
Entry ID 10998
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-05-15 (Qiang Li)
Peroxidase information: EglPrx179
Name EglPrx179
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx179
start..stop
S start..stop
EgrPrx[P]179 224 9e-78 1..114 16..142
EguPrx[P]140 219 9e-76 1..113 16..141
EgrPrx177 224 5e-75 1..114 206..332
EcamPrx177 221 6e-74 1..114 206..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..231 231 N° 2 271..384 114  
join(1..231,271..384)


exon

Literature and cross-references EglPrx179
Protein sequence: EglPrx179
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   114
PWM (Da):   %s   12255.07  
PI (pH):   %s   8.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RLYNFTNTTSSGADASIDPSFVSQLQSLCPQNGDGTRRVALDTGSPSRFDASFFANLRSGRGVLESDQKLWTDASTKQLDFNTEFAKSMVKMSKIGVKTGTDGEIRKICSAINA*

Retrieve as FASTA  
Remarks Partial sequence from NGS. 5' and PS are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGACTCTACAACTTCACCAATACTACGTCAAGTGGAGCGGACGCTTCCATTGATCCTTCCTTTGTTTCTCAACTCCAGTCTCTGTGTCCGCAAAACGGTGATGGCACAAGGCGTGTTGCC
CTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTCGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAAAAGCTATGGACCGATGCCTCCACCAAA
ACNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAATTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAAGATTGGTGTGAAGACGGGGACCGATGGTGAAATTAGGAAA
ATATGCTCCGCCATTAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGACTCTACAACTTCACCAATACTACGTCAAGTGGAGCGGACGCTTCCATTGATCCTTCCTTTGTTTCTCAACTCCAGTCTCTGTGTCCGCAAAACGGTGATGGCACAAGGCGTGTTGCC
CTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTCGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAAAAGCTATGGACCGATGCCTCCACCAAA
CAATTGGAC
TTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAAGATTGGTGTGAAGACGGGGACCGATGGTGAAATTAGGAAAATATGCTCCGCCATTAATGCATGA

Retrieve as FASTA