Entry information : OsPrx90
Entry ID 1100
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx90
Name OsPrx90
Class Class III peroxidase    [Orthogroup: Prx114]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx90
start..stop
S start..stop
HvPrx71 556 0 35..337 46..347
SiPrx27 554 0 34..337 21..325
TaPrx54 552 0 35..337 43..344
SbPrx143 551 0 39..337 40..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28667511..28667750 240 N° 2 28667846..28668037 192 N° 3 28669145..28669310 166 N° 4 28669785..28670200 416
join(28667511..28667750,28667846..28668037,28669145..28669310,28669785..28670200 )


exon

Literature and cross-references OsPrx90
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5Z8H5
DNA ref. GenBank:   NC_008399.1 (28667511..28670197)
Protein sequence: OsPrx90
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (304)
PWM (Da):   %s   35928.4 (32523.5) Transmb domain:   %s   i13-35o
PI (pH):   %s   9.09 (8.38) Peptide Signal:   %s   cut: 34 range:34-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGQRRRSGPRRQSQSVVVVVVAVLLATASCAAAQLSQSYYASTCPNVETLVRGAVTQKLKETFNAAPGTLRLFFHDCFVRGCDASVLIAGPDDEHSAGADTTLSPDALDLITRAKAAVDADAQCANKVSCADILALAARDVVSQAGGPYYQVELGRLDGKVGTRAVVKHSLPGAAFDLDQLNKLFATNGLTQTDMIALSGGHTIGVTHCDKFVRRLYQFKGAAPQYSPPMNLAFLRQMRQTCPLSYSPTTVAMLDAVSPNKFDNGYFQTLQQLKGLLASDQVLFADRRSRATVNYFAANQTAFFDAFVAAITKLGRVGVKTAAGSDAEIRRVCTKVN

Retrieve as FASTA  
Remarks chromosome 6. 17 ESTs. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCAGAGGAGGAGGTCGGGGCCGCGGCGTCAGAGCCAGAGCGTGGTGGTGGTGGTGGTCGCCGTGTTGCTGGCGACGGCGTCCTGCGCGGCGGCGCAGCTGAGCCAGAGCTACTAC
GCGTCGACGTGCCCCAACGTGGAGACGCTCGTCCGCGGCGCCGTCACGCAGAAGCTCAAGGAGACCTTCAACGCCGCGCCTGGGACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GTACAGTAGTGACAGACCAGCCCGAGAACTTGATGCCATCGACTCCGTGTTCTTCGTGTTGCTGATCGTGCCGTGTCGTGCTCGTGCGTGTGCAGGGGTGCGACGCGTCGGTGCTGATCG
CGGGGCCGGACGACGAGCACAGCGCGGGCGCGGACACGACGCTGTCGCCGGACGCGCTGGACCTCATCACCCGCGCCAAGGCCGCCGTCGACGCCGACGCCCAGTGCGCCAACAAGGTCT
CCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
GTAAACACACCCACACCATCCCCTCTCTCTCTCTCTCTCGGCGTGCGCGCGCGTGCCGCTTCGAGTGCGCTCG
CTTGAGAGAAAACTTCGCTTTCGCCCGTAGTTTTTGCCGTTTTTTCACCGTGCGCGCGCGACAGCGATGATGAGGGTGACATGCCATGCCGCCCCGCACGGCGCCGCAGCGTGTTCCCGG
CTCGGCACGAGTCCACGCTCTTAGCTGTGCGGCAATTATGCGCCTCTCGCTGTGCGCTTCGTTATATCGATCGGTCCGGTGCTTTGCTACACTAAACAGAAGCCCAAAATACTCCACAGA
AGCAAGCCAAGCAGAGAATTCATTCACCTAACCGAATGGAATCGGAAAAATTGGGATTTGGCGCTAAAATTCGCGAGGCCGAGGGAGGTGGTCCCCCCTAGCATGTCCGAATTCAGCTGT
CCTATTAATTCAGAGCAGGGTGTCCATGTAACCACCACTGCATAGTGGTCGTCGTCTCGTCAGCGAGAGTTACTGCGATGTCGTTGCTTTGGTCTTTCTTCTTCTCCGATTGGATCCATC
AATTCTTTTTTCTCCAGCGTGAAAAACAAGTATAGGCCGAATTTAGTTCCAAAGTTTTTTTTTAAACTTCCAACTTTTCCATCCCATTAAAACTTTTCTACACACAAACTTCCAACTTTT
TCATCACTTTATTTCAATTTCAATCAAACCTCTAATTTTAGCGTCAACTAAACACACCGTTCAAATCTACTACTACTCCTACGCGGTATGGGTTGGGGCGCTTAAATGAGCCGCGCGCGT
ACGTACGGTACGGCGATACAGAAGCAGAGACGCCGGCGTCCAACACGTACCTACCAAACCAGCCACGCTCTCGACAGTCGACAGGCAGGCTGTGGACTCGTAGAGCTACGGAAATCTGCC
AATTATTATTAGGCCATGCCGAAAATTCTGCTCGCACACACACACACACTCGTGAGTAGTTGCAGTTGATGGCAAGAACGGCGTGCTGTAGTAGCAGTAAAATTGCTTGGATTTCACTGC
AAGGCAAAGGCAAAAGTTGTATGATGTGTCATGTGTGGTGGTAATCACAGTGGTGGTGGTTGTCGTTGATGCAGGCAGGAGGACCCTACTACCAGGTGGAGCTGGGGCGGCTTGACGGCA
AGGTCGGGACGCGCGCCGTGGTGAAGCACAGCCTCCCCGGCGCCGCCTTCGACCTCGACCAGCTCAACAAGCTCTTCGCCACCAACGGCCTCACCCAGACCGACATGATCGCCCTCTCAG
GTATCAAAAACATGACAAATTTTACAGTACCAAAATTTTGTATTCTGAGTGCCAAATTCTACACTAGAAAATATAACAATCTAAAACCGGATGTGACACTTTATAGTACAACGAATCTGG
ACAGAAAACATATCTAGATTCGTTATACTATGAAGTGTCTCGTTCGGTACTAGATTGCTATATTATAGGACGGAGAGAGTATCTTCTTAAGAATTATAAAATCACTCTAAATCGCTATAA
AATTGGGAATTCTCGGTGTTAAATGTTACAATAGAATAGAATATATGGTATCTTGGAGTATCTTGAGCTATATCTTCTTAAAAATTGTAAAATCACTCTAAAAACGTACTAACACAAATT
CCTTTTTATAAAATCAAATTCTAAAACTAATTTATAAAATTCAAATGAACTTTTGGGTGAATCTGTTTTCATCGTCTGCTTGTTAGCTTATCAGTCGTAACGAATGTGGTGCAGGAGGGC
ACACGATAGGGGTGACGCACTGCGACAAGTTCGTGCGGCGGCTGTACCAGTTCAAGGGGGCGGCGCCGCAGTACAGCCCGCCGATGAACCTGGCGTTCCTGCGGCAGATGAGGCAGACGT
GCCCGCTCAGCTACAGCCCGACCACCGTCGCCATGCTCGACGCCGTCTCGCCCAACAAGTTCGACAATGGCTACTTCCAGACGCTGCAGCAGCTCAAGGGCCTCCTCGCCTCCGACCAGG
TGCTCTTCGCCGACCGCCGCTCGCGCGCCACCGTCAACTACTTCGCCGCCAACCAGACCGCCTTCTTCGACGCCTTCGTCGCCGCCATCACCAAGCTCGGCCGCGTCGGCGTCAAGACGG
CCGCCGGCTCCGACGCCGAGATCCGGCGAGTCTGCACCAAGGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCAGAGGAGGAGGTCGGGGCCGCGGCGTCAGAGCCAGAGCGTGGTGGTGGTGGTGGTCGCCGTGTTGCTGGCGACGGCGTCCTGCGCGGCGGCGCAGCTGAGCCAGAGCTACTAC
GCGTCGACGTGCCCCAACGTGGAGACGCTCGTCCGCGGCGCCGTCACGCAGAAGCTCAAGGAGACCTTCAACGCCGCGCCTGGGACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGGTGCTGATCGCGGGGCCGGACGACGAGCACAGCGCGGGCGCGGACACGACGCTGTCGCCGGACGCGCTGGACCTCATCACCCGCGCCAAGGCCGCCGTCGACGCC
GACGCCCAGTGCGCCAACAAGGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
GCAGGAGGACCCTACTACCAGGTGGAGCTGGGGCGGCTTGACGGCAAG
GTCGGGACGCGCGCCGTGGTGAAGCACAGCCTCCCCGGCGCCGCCTTCGACCTCGACCAGCTCAACAAGCTCTTCGCCACCAACGGCCTCACCCAGACCGACATGATCGCCCTCTCAG
GA
GGGCACACGATAGGGGTGACGCACTGCGACAAGTTCGTGCGGCGGCTGTACCAGTTCAAGGGGGCGGCGCCGCAGTACAGCCCGCCGATGAACCTGGCGTTCCTGCGGCAGATGAGGCAG
ACGTGCCCGCTCAGCTACAGCCCGACCACCGTCGCCATGCTCGACGCCGTCTCGCCCAACAAGTTCGACAATGGCTACTTCCAGACGCTGCAGCAGCTCAAGGGCCTCCTCGCCTCCGAC
CAGGTGCTCTTCGCCGACCGCCGCTCGCGCGCCACCGTCAACTACTTCGCCGCCAACCAGACCGCCTTCTTCGACGCCTTCGTCGCCGCCATCACCAAGCTCGGCCGCGTCGGCGTCAAG
ACGGCCGCCGGCTCCGACGCCGAGATCCGGCGAGTCTGCACCAAGGTCAACTAA

Retrieve as FASTA