Entry information : EglPrx[P]182
Entry ID 11001
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EglPrx[P]182
Name EglPrx[P]182
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]182
start..stop
S start..stop
EgrPrx[P]42 436 4e-156 1..267 40..319
EguPrx[P]42 431 4e-154 1..267 40..319
EcamPrx[P]42 427 1e-152 1..263 44..320
EguPrx[P]46 422 7e-151 1..263 38..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4..99 96 N° 2 859..1050 192 N° 3 1193..1357 165 N° 4 1474..1821 348
join(4..99,859..1050,1193..1357,1474..1821)


exon

Literature and cross-references EglPrx[P]182
Protein sequence: EglPrx[P]182
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   264
PWM (Da):   %s   27184.76  
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LDTIKCGMSSVVSSKARMGVPLLRLCFHDCFIHGLILLEYTANFIxxKNISPNANSIRVFEVIDMIKSQLESTxxKVLSYANTLVVTA*DSIVALSLGRRDSTSASQSAAISNIPAPSLNLNDLISSFxxxxxxxxEMAALLGHCLFFFTYRAQLYNNQHRICNITESKLSELRRRQQPLSS*RHEPDVLRQCLLKNLQIQKDLLNSN*QLFSGGAIDFQGNAYSSNSATFMTDFSNAMVKMGNLNPLTGSSSxxxxNYGKVNSCSF

Retrieve as FASTA  
Remarks Pseudogene from NGS. 5' and PS are missing due to NNNN. Stops in frame. contig_98572
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCGACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCTCCGCCTTTGCTTCCACGATTGCTTCATCNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTCCAACCAACCACG
GAGTCAAAAGAATTATTAGATTCGCGTCTACACAAGTTAGGTAGGAGGTTCACATATTGAATTAGCTGAGTCTGACACCTTTTTGGTATTTTGTGGTGCCATGCATTTCTGTGAGTTTAT
TATATTATTAATAGATTTTTTTTGTTATAACAAAATAATTTTTTTGGTAAATGAAAAAAACTTTTTCATGAGTATCGTTAGTATATACGCTGCCGGCGTAAAAATTATTTTTTTTACAAA
CGGACTTATCCACCCTTAATTTGGCTGTTAGTGAGGGGTTTGGAATCTTCAAATCATGGATAAGAATGGTTATGTAAAGTTTTCTTTAGACCGATAGTGCACGCTTTAATTTTCTTATAT
TACAAAAACGATGTTGTCGATCAGATGTATATGTGATTAACTACCTGGTTTAAATCCAATGAACTCGATGAATTGGATCACGTAAAGTCCTGAACGTTGGAGCTTAAAAATGATATTTNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTGCAACCATTGAATTTAATGGACTCCAATCCCATCGATTTTCTATTTAGAAGGACTAAT
GTGTGGCGTAGATGCCACGGGTTGATTTTATTGGAGTACACCGCAAACTTCATTGNNNNNAAGAATATTAGCCCGAATGCCAATTCTATACGGGTATTCGAGGTGATTGATATGATCAAG
TCCCAATTAGAGAGCACNNNNNNNAAGGTCCTATCCTATGCCAACACATTGGTTGTTACTGCATGAGATTCCATCGTTGCCTTAAGT
GCACATTTTCTTCTCAATTCTAGAGATCAATTG
TGAGGAGAAAAAAATCACATGTTGTGTTCTCCATGCTATATTAATACTAACACATATGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTGGAAGGAG
AGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGCAACATTCCTGCCCCAAGTTTGAACCTCAACGACCTCATCTCTTCCTTCTNNNNNNNNNNNNNNNNNNNNNAAGAAATGGCGGC
ACTCTTAGGTCATTGTCTTTTTTTTTTCACCTAT
TAAGAAAGAATTTATGATAATGCTCGATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGGCCCAACTTTACAATAATCAACACCGCATATGCAACATCACTGAAAGCAAACTGTCCGAGCTCCGTAGGCGACAACAACCCCTCTCC
TCTTGACGTCACGAGCCCGACGTCCTTCGACAATGCCTTCTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGAACTAGCAATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGG
AATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACGGGCTCAAGCAGTCANNNNNNNNAGAACTATGGAAAA
GTCAACTCATGTTCGTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCGACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCTCCGCCTTTGCTTCCACGATTGCTTCATCCACGGGTTGATTTTATTGGAGTAC
ACCGCAAACTTCATTGNNNNNAAGAATATTAGCCCGAATGCCAATTCTATACGGGTATTCGAGGTGATTGATATGATCAAGTCCCAATTAGAGAGCACNNNNNNNAAGGTCCTATCCTAT
GCCAACACATTGGTTGTTACTGCATGAGATTCCATCGTTGCCTTAAGT
CTTGGAAGGAGAGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGCAACATTCCTGCCCCAAGTTTGAAC
CTCAACGACCTCATCTCTTCCTTCTNNNNNNNNNNNNNNNNNNNNNAAGAAATGGCGGCACTCTTAGGTCATTGTCTTTTTTTTTTCACCTAT
CGGGCCCAACTTTACAATAATCAACAC
CGCATATGCAACATCACTGAAAGCAAACTGTCCGAGCTCCGTAGGCGACAACAACCCCTCTCCTCTTGACGTCACGAGCCCGACGTCCTTCGACAATGCCTTCTCAAGAACTTGCAAATC
CAAAAGGATCTTCTCAACTCGAACTAGCAATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTG
AAGATGGGTAACCTCAACCCGCTCACGGGCTCAAGCAGTCANNNNNNNNAGAACTATGGAAAAGTCAACTCATGTTCGTTC

Retrieve as FASTA