Entry information : EglPrx[P]183
Entry ID 11002
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-15 (Qiang Li)
Peroxidase information: EglPrx[P]183
Name EglPrx[P]183
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]183
start..stop
S start..stop
EcamPrx[P]183 186 4e-61 1..147 1..209
EgrPrx94 136 3e-40 15..134 15..193
EglPrx94 136 3e-40 15..134 15..193
EcamPrx94 135 1e-39 15..134 15..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..147 147 N° 2 309..479 171 N° 3 612..734 123  
join(1..147,309..479,612..734)


exon

Literature and cross-references EglPrx[P]183
Protein sequence: EglPrx[P]183
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   144
PWM (Da):   %s   14369.42  
PI (pH):   %s   4.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEVxxxxxxxxxxxHLVSAAVQAGGLLGTVPIEEYGLSFQ*YQQSCPQFPDFI*LGYYDxxV*GCNTSILLNHEGSERSAEVSKTLRGFEIIDDIKTELEKSCLRTMGHENITSLLQLFQSQGLNVLDLVVLSGELLLLLLFSKIKE

Retrieve as FASTA  
Remarks Pseudogene from NGS. 5' and PS are missing due to NNNN. Stops in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCACTTGGTTTCAGCCGCAGTCCAAGCTGGAGGGCTGCTCGGGACGGTGCCGATAGAAGAGTACGGGCTGTCGTTCCAG
TAATACCAGCAGAGTTGCCCCCAATTC
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNCTGCTATTTATTTTGATTGCTATCAAGAAAGTGAATGATTGAATTTTTCCAGACTTCATTTAACTTGGTTATTATGATNNNNNTGTATAGGGATGTAACA
CGTCGATATTGTTGAACCATGAGGGAAGCGAGAGAAGCGCTGAAGTGAGCAAGACCCTTAGGGGGTTCGAAATAATCGACGACATAAAGACGGAGCTCGAGAAGAGCTGCCTGAGGACN
N
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNGCCGATGGGCCACGAGAACATCACGTCGCTCCTCCAGCTCTTCCAATCCCAAGGATTAAATGTCCTTGACTTGGTTGTTCTCTCAGGTGAACTTCTTTTATTGCTTCTATTTT
CAAAAATCAAAGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCACTTGGTTTCAGCCGCAGTCCAAGCTGGAGGGCTGCTCGGGACGGTGCCGATAGAAGAGTACGGGCTGTCGTTCCAG
TAATACCAGCAGAGTTGCCCCCAATTC
CCAGACTTCATTTAACTTGGTTATTATGATNNNNNTGTATAGGGATGTAACACGTCGATATTGTTGAACCATGAGGGAAGCGAGAGAAGCGCT
GAAGTGAGCAAGACCCTTAGGGGGTTCGAAATAATCGACGACATAAAGACGGAGCTCGAGAAGAGCTGCCTGAGGACN
ATGGGCCACGAGAACATCACGTCGCTCCTCCAGCTCTTCCAA
TCCCAAGGATTAAATGTCCTTGACTTGGTTGTTCTCTCAGGTGAACTTCTTTTATTGCTTCTATTTTCAAAAATCAAAGAA

Retrieve as FASTA