Entry information : EglPrx188
Entry ID 11013
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2020-02-13 (Christophe Dunand)
Peroxidase information: EglPrx188
Name EglPrx188
Class Class III peroxidase     [Orthogroup: Prx074]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx188
start..stop
S start..stop
EcamPrx188 473 3e-171 1..251 1..319
EgrPrx169 464 8e-168 1..251 1..320
EcamPrx200 442 4e-159 1..251 1..320
EcamPrx[P]169 387 7e-137 1..251 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 769..843 75 N° 3 1002..1181 180 N° 4 1272..1553 282
join(1..219,769..843,1002..1181,1272..1553)


exon

Literature and cross-references EglPrx188
Protein sequence: EglPrx188
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251 (226)
PWM (Da):   %s   26718.31 (23930.8)  
PI (pH):   %s   7.45 (6.10) Peptide Signal:   %s   cut: 26 range:26-251
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNTNRKIYFVFFVCAIALRSALAQLSNQDYYTQRCPRALETIQSAVRSAVANETRMGASLLRLHFHDCFVNEKTAFPNVNSVRGFDVIDTIKLKVELDGPSWQVQLGxxDSTTASLNDANIDLPAPTLNLSGLVASFSNKGFTAKEMVTLSGSHTIPSSGGDNNLSPLDITSPAFFDNAYFSNLVSQEGLLHSDQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRTNCRKVN

Retrieve as FASTA  
Remarks Partial sequence from NGS. Short PS is missing due to NNN in DNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGTCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
CTGGAGACCATCCAATCTGCTGTGAGATCGGCGGTGGCCAACGAGACTCGCATGGGAGCATCCTTGCTCCGACTTCACTTTCACGATTGCTTTGTCAAT
GCAAGTCTCTTCCGCTTTCTC
GCTCAGTTCTATCCTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCCGCGTTTATT
TTCGATGGTTCCTCGCATGTCTGCTTAATTCACTCCTGATTGAAAATGGCCAACATTTTGGAGATTCGGATCTTTGAGGAATATTGCAACAAGTGAGCTACGTGGGCCAATGATTCCATT
AAATTAAGAAAGAACACGCATTGAGCTGATCATAGCACACCATTTAGACGACCTGCCANNNNNNNNNNNNNNNNNATTCTATTCTAACCGATGAATTGTCTCTCTCTTAACGTTCCTTTC
CGGTTGCTTGCAAAAAAATTTATTTTGTTTCCTCATAGGTTCAATATTTAGATCATCCTTTCTAGTTCGTTAGATCTTCTAAACTTAATAAGATGTTATTTTTTTTTTTTTTTTTGATAG
GGATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGAAGACAGCGTTTCCCAACGTGAACTCCGTGAGGGGATTCGATGTGATTGACACCATCAAGTTAAAAGTG
GAG
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGCTAGGGACTCCATCGTCATTGTAAGCATTGACACTTGAAATTTCTTTAAACATACAAAGAAACTATTA
TTTTCCTAAACTTATGTGGATTCAATTAATTTGATGTTTAGTTGGATGGACCGAGTTGGCAAGTCCAACTGGGAAGNNNAGACTCAACCACAGCAAGCCTAAATGATGCTAATATCGACC
TCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCGCCTCTTTCTCTAACAAAGGCTTTACTGCCAAAGAAATGGTAACGCTATCAGGATCCCACACCATA
NNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCAGCTCTGGAGGCGACAACAACCTATCCCCTCTTGACATCACAAGCC
CGGCGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGGATCAACAATTGTTTAGTGGAGGTTCGACGAATGCTCAAGTGGCTGCCTACAGCAAAA
ATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTCTTACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAGAAAAGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGTCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
CTGGAGACCATCCAATCTGCTGTGAGATCGGCGGTGGCCAACGAGACTCGCATGGGAGCATCCTTGCTCCGACTTCACTTTCACGATTGCTTTGTCAAT
GAGAAGACAGCGTTTCCCAAC
GTGAACTCCGTGAGGGGATTCGATGTGATTGACACCATCAAGTTAAAAGTGGAG
TTGGATGGACCGAGTTGGCAAGTCCAACTGGGAAGNNNAGACTCAACCACAGCAAGCCTAAATGAT
GCTAATATCGACCTCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCGCCTCTTTCTCTAACAAAGGCTTTACTGCCAAAGAAATGGTAACGCTATCAGGATCCCACACCATA
CCCAGC
TCTGGAGGCGACAACAACCTATCCCCTCTTGACATCACAAGCCCGGCGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGGATCAACAATTGTTT
AGTGGAGGTTCGACGAATGCTCAAGTGGCTGCCTACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTCTTACCGGGTCTAGC
GGTCAGATCAGGACCAATTGCAGAAAAGTCAATTGA

Retrieve as FASTA