Entry information : EglKat02
Entry ID 11015
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2016-01-17 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-17 (Christophe Dunand)
Peroxidase information: EglKat02
Name EglKat02
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglKat02
start..stop
S start..stop
EguKat02 1021 0 1..492 1..492
EgrKat02 1021 0 1..492 1..492
PpeKat01 949 0 1..492 1..492
NtKat03-1B 946 0 1..492 1..492
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 184..198 15 N° 2 533..629 97 N° 3 1157..1434 278 N° 4 1784..2560 777
N° 5 2767..2856 90 N° 6 3377..3444 68 N° 7 3519..3612 94 N° 8 3756..3815 60
join(184..198,533..629,1157..1434,1784..2560,2767..2856,3377..3444,3519..3612,37 56..3815)


exon

Literature and cross-references EglKat02
Protein sequence: EglKat02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   492
PWM (Da):   %s   56727.18  
PI (pH):   %s   6.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPYKYRPSSAHDSSFWTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTRGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPQDFRHMEGFGVNTYTLLNESGKAHYVKFHWKPTCGVKSLLEEEAIRVGGSNHSHATKDLYDSIAAGNYPEWQLYIQVIDPDHEDKFDFDPLDVTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPMPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQDRFIGRWVETLSDPRVTQEIRSIWISYWTADKSLGQKIASCLNVRPSM*

Retrieve as FASTA  
Remarks Complete sequence from NGS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCCGTACAAGGTATCGATTGGCCCTTTTCCCCTTTCCCGCTTCGAATCGTCGGATCTTCCGATCTTCGCGGGCGGTGAAATTCTTTTTGTCCCTTACGTTTTGCGATACTTCTGA
TGGGGCTGATCTTCGCTGATCGAGCGGGAATTTTCGAGTTTTTTCGCGTCTGTAAAGCTCGATTCGTTTCCTAGTTTCCGAGAATTTGGAGAAAGAGTACTCCCTGTTGGGATCCATTAG
GGAATTGTTCGTGCTAGGGCTCTGTTTCGTCGATTGTCGGATCTTTATCAATCGCACATGACCGTTGCTAAATTGTTGATGTTTCCGCTGCGAATTGTGGATGTCGCAGTATCGTCCGTC
GAGCGCTCACGATTCCAGCTTCTGGACGACCAACTCCGGCGCCCCTGTCTGGAACAATAACTCATCCCTGACGGTTGGAACTAGAG
GTACGATTACCTCTACGGATCTCAGAGCTGTTTT
CTTTACCAAAAGATATGTAATTCTACGCTAGTTGCACTTCAAAGGGGGCGTTTGTTAAACTTTAGCTTTTAATGGTTATGACATGGGAAATTGCTAGGCCAAGCACTTTTTGCATTCTTG
CTAAAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAACATGTCTATGGTCCATGCAAACCTCTTGAGGCCTAGATTGATCAAGCTGACAATGCATAGAAAAATATGAT
AGAAAATGCAGTAATTTTTATTTCACAATCCAGAGGCACAGTCGTGGACACTCAGCTACCTGTCCTGCAAATGAATTGGTTCAGTGCAGGCCTCTTTGGCCTATGTATGTGTCCCTCACC
CAAAACAGAAAAATGTTAACAGTAATTTAGCTTATCTCGGAGGCATACTTTTTGTTATCCTTAAGCTTTCCGAACATATTTGTCAAGATACAAAGCTTAACAGCATTTAAACGAAATTTT
CTTTTATTTACAGGTCCTGTTCTCCTCGAGGATTATCATCTGTTGGAGAAAATTGCCAATTTCGATAGAGAGAGAATACCTGAGCGGGTGGTCCATGCCAGGGGAGCGAGCGCAAAAGGA
TTTTTCGAGGTCACTCACGATATCTCTCAGTTGACATGTGCTGATTTTCTTCGGGCTCCAGGAGTTCAGACACCTGTAATTGTCCGTTTCTCCACTGTCATCCATGAGCGTGGCAGCCCT
GAAACCCTTAGGGACCCTCGAGGTTTTGCAGTAAAGTTTTACACCAGAGAG
GTATGAGATGATTGCATGTTTTAGAATCTGCAAATTTATTCTTTTCATCTTCGTTTGTTGACCAGAAGT
GTATTTAGTTTACCGATGATCCAGATACAGTGTAGAATTCAGTAGAGTGTTGGCGTCTGTGCTTTAAATCCATGCAGTTCTTAACCATGTGATGATGGATTTTATCTTGACACTTCAACA
TGATTAGTTGAAGATGACTTTATCAAAGAGCTGTAATACAAAATTTTATTTCAATTACAAGAGAAGTCAGAACATCAAAATAGAATTAGTGTTTCTTCACGTAATTGTGTGGTTTCTCAT
TTTTCTTCTTTTCTTTGACCATTTGTTTTTCTGAATGCAGGGAAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTTTTTATTCGCGATGGTATGAAATTTCCAGACATGGTCCATGC
TCTTAAACCCAACCCGAAGTCTCACATCCAGGAGAACTGGAGAATAGTTGACTTCTTCTCCCACCATCCTGAGAGTTTGCACATGTTTTCCTTCCTCTTCGATGACGTTGGTGTTCCTCA
AGACTTCAGACACATGGAAGGATTTGGGGTTAATACTTACACCTTACTTAACGAGTCTGGAAAGGCACATTATGTGAAATTTCACTGGAAACCAACTTGTGGAGTGAAGTCTTTGCTGGA
GGAGGAGGCAATACGTGTTGGAGGATCAAATCACAGTCATGCGACTAAGGATCTTTATGACTCGATTGCTGCTGGCAATTACCCAGAGTGGCAACTCTACATCCAAGTTATAGATCCTGA
TCATGAAGACAAATTTGACTTTGATCCACTTGATGTGACAAAAATATGGCCTGAGGACATCGTGCCTCTGCAACCAGTAGGCCGCTTGGTGTTGAATAAGAACATCGATAACTTCTTTGC
GGAAAATGAACAACTAGCATTTTGCCCTGCAATTGTGGTCCCTGGTGTCTATTACTCTGATGATAAGCTGCTCCAAAGTCGGATTTTCTCCTATGCTGATACTCAGAGACACCGCCTTGG
ACCAAACTATCTTCAACTCCCTGTTAATGCTCCTAAGTGCACTCATCACAACAATCACCATGAAGGTTTAATGAATTTCATGCACAGGGATGAAGAG
GTAATGATCTTTATTTTCTGTTT
GCTTGATAGCGGGCTGGGAACAAATATGCCACAAGCATGACCTAATAACATATTCTTAGCTGGTTGTAATTGAATTGGCTACAGTAGCCTATCGATGCAACTGACCCGGTCGAATCAGTT
TGTTTTTATTTTTTTTTAAATGAGGAACTAATGATGTGGTGTATCCATGATGCTGATTTGTAGGTAAATTATTTCCCTTCAAGGTTTGATTCTGTTCGTCATGCAGAAAAGTTTCCCATG
CCTCCTCCAGTCTTGAATGGAAAGCGAGATAGG
GTAAGTTTCTGGGCCTACCTTGTGCATTTATATCAACATTGACTCTTAAAACATGGGCCCGCCTCTAGGAGAAATAATTAACACTTG
CGTTGAAGTTGTACATTACGATAGTTAATCTGTGGCAAGTTGAAAGGCATTGTGGTGCTGCTGTTTTCTGTTTGGACTTTGGATAAAATTGATTTAACTCAAATTCCGTTGTGCTGGTGC
AATGATCCTGGTGATATCATCCAGCACATTTTCTTCTGCTAGTCTCTCATGTACAAAATTGCCTTTGAGATCGTCCCTACTTGTCCTCAGGGCAATGACAACTCCTTAAAACGACCACTT
TATTGAAATGAGGGGGAGTGTAGTAGCTCCGCTGAATTTTTAGACTAAGCTTAAAACTAAGAAAAGAAGGAGCAAGATGTTATAACTAGAAAAGAGATTCTCTGGCTAAAAAAATGAATT
TCTTGGGGTTTGCCTTGGATTGGATATTTCTGCTGCTGGTATTCATCTCTATGTGAACTTACTGATCATGCAGTGCATGATTGAGAAGGAGAACAACTTTAAGCAACCGGGAGAGAGATA
TCGATCCTGGGCACCGGACAG
GTACCTTTCAACCATTGTCTCCCGAGTAGATGTGTAATTTACTGGTCGCTCATGTGTTTCAAATTTGTCGCCAGGCAAGACCGGTTTATTGGCCGCTGG
GTTGAGACATTATCTGATCCCCGGGTTACCCAGGAGATCCGCTCCATCTGGATCTCTTACTGGACTCAG
GTAAGCTATAAGTATTCACCCCTTTTGCTTTATCCAATGCTACCACAATTC
GTTTAGTGTTGTTACCTGGAAATTGAGAACGTCTGTCTAGAACATGCTCAAATGATCATATGCTGATGGCCTACGATGCATTTTTGCTACAGGCTGACAAATCGCTTGGTCAGAAGATAG
CTTCTTGCCTCAATGTGCGGCCAAGCATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCCGTACAAGTATCGTCCGTCGAGCGCTCACGATTCCAGCTTCTGGACGACCAACTCCGGCGCCCCTGTCTGGAACAATAACTCATCCCTGACGGTTGGAACTAGAGGTCCTGTT
CTCCTCGAGGATTATCATCTGTTGGAGAAAATTGCCAATTTCGATAGAGAGAGAATACCTGAGCGGGTGGTCCATGCCAGGGGAGCGAGCGCAAAAGGATTTTTCGAGGTCACTCACGAT
ATCTCTCAGTTGACATGTGCTGATTTTCTTCGGGCTCCAGGAGTTCAGACACCTGTAATTGTCCGTTTCTCCACTGTCATCCATGAGCGTGGCAGCCCTGAAACCCTTAGGGACCCTCGA
GGTTTTGCAGTAAAGTTTTACACCAGAGAG
GGAAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTTTTTATTCGCGATGGTATGAAATTTCCAGACATGGTCCATGCTCTTAAACCC
AACCCGAAGTCTCACATCCAGGAGAACTGGAGAATAGTTGACTTCTTCTCCCACCATCCTGAGAGTTTGCACATGTTTTCCTTCCTCTTCGATGACGTTGGTGTTCCTCAAGACTTCAGA
CACATGGAAGGATTTGGGGTTAATACTTACACCTTACTTAACGAGTCTGGAAAGGCACATTATGTGAAATTTCACTGGAAACCAACTTGTGGAGTGAAGTCTTTGCTGGAGGAGGAGGCA
ATACGTGTTGGAGGATCAAATCACAGTCATGCGACTAAGGATCTTTATGACTCGATTGCTGCTGGCAATTACCCAGAGTGGCAACTCTACATCCAAGTTATAGATCCTGATCATGAAGAC
AAATTTGACTTTGATCCACTTGATGTGACAAAAATATGGCCTGAGGACATCGTGCCTCTGCAACCAGTAGGCCGCTTGGTGTTGAATAAGAACATCGATAACTTCTTTGCGGAAAATGAA
CAACTAGCATTTTGCCCTGCAATTGTGGTCCCTGGTGTCTATTACTCTGATGATAAGCTGCTCCAAAGTCGGATTTTCTCCTATGCTGATACTCAGAGACACCGCCTTGGACCAAACTAT
CTTCAACTCCCTGTTAATGCTCCTAAGTGCACTCATCACAACAATCACCATGAAGGTTTAATGAATTTCATGCACAGGGATGAAGAG
GTAAATTATTTCCCTTCAAGGTTTGATTCTGTT
CGTCATGCAGAAAAGTTTCCCATGCCTCCTCCAGTCTTGAATGGAAAGCGAGATAGG
TGCATGATTGAGAAGGAGAACAACTTTAAGCAACCGGGAGAGAGATATCGATCCTGGGCACCG
GACAG
GCAAGACCGGTTTATTGGCCGCTGGGTTGAGACATTATCTGATCCCCGGGTTACCCAGGAGATCCGCTCCATCTGGATCTCTTACTGGACTCAGGCTGACAAATCGCTTGGTCAG
AAGATAGCTTCTTGCCTCAATGTGCGGCCAAGCATGTGA

Retrieve as FASTA