Entry information : OsPrx92
Entry ID 1102
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx92
Name OsPrx92
Class Class III peroxidase    [Orthogroup: Prx123]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx92
start..stop
S start..stop
OsPrx93 624 0 1..314 1..314
OsPrx91 454 2e-162 13..314 15..319
ZmPrx133 454 2e-162 4..314 6..320
SiPrx44 452 5e-162 1..314 2..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28644345..28644752 408 N° 2 28644041..28644200 160 N° 3 28643570..28643946 377  
complement(join(28643570..28643946,28644041..28644200,28644345..28644752))


exon

Literature and cross-references OsPrx92
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5Z8H7
DNA ref. GenBank:   NC_008399.1 (28644752..28643573)
Protein sequence: OsPrx92
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (291)
PWM (Da):   %s   33552.6 (31173.3)  
PI (pH):   %s   7.7 (7.24) Peptide Signal:   %s   cut: 24 range:24-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSFHFVVVLALAVAISSPLAVAQLKQNYYASICPNLENIVRGSVQRSMQQSPIAAPATLRLFFHDCAVRGCDASVMIINPNGDDEWRNPDDQTLKPEGFTTVIAAKAAVDSDPQCRNRVSCADILALATRDSVFLSGGPDYAVELGRFDGRVSTRNSVNLPHGNFNLDQLTGYFGSLGLSPTDMVALSGGHTIGAASCSFFGYRLGGDPTMDPNFAAMLRGSCGSSGFAFLDAATPLRFDNAFYQNLRAGRGLLGSDQTLYSDPRSRGLVDRYAANQGAFFNDFVAAMTKLGRVGVKSPATGGEIRRDCRFPN

Retrieve as FASTA  
Remarks chromosome 6. No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGCTTCCATTTCGTCGTCGTCCTCGCGCTGGCGGTGGCGATCTCGTCGCCATTGGCGGTGGCGCAGCTGAAGCAGAACTACTACGCCAGCATCTGCCCGAACCTCGAGAACATC
GTGCGCGGGTCCGTGCAGAGGTCGATGCAGCAGTCGCCGATCGCGGCGCCGGCGACGCTGAGGCTCTTCTTCCACGACTGCGCCGTCCGCGGGTGCGACGCGTCGGTCATGATCATCAAC
CCGAACGGCGACGACGAGTGGAGGAACCCCGACGACCAGACGCTGAAGCCGGAGGGGTTCACGACGGTGATAGCCGCCAAGGCCGCCGTCGACAGCGACCCCCAATGCCGGAACAGGGTG
TCCTGCGCCGACATCTTGGCCCTCGCCACTAGAGACTCCGTCTTCCTG
GTAACTCACACTCACTTATCTGTATCGAGTTGCATGCACCGACCAGTTTAACTCAAATGTTTTAGCTCATAA
GAGAAAACTGGCAATTTAGTTTATATTCGAACACGCACGAATGGCCATTGATGGGTTGGCTGCATGATGCAGAGTGGAGGACCGGACTACGCGGTGGAGCTCGGCAGGTTCGACGGCAGG
GTGTCGACCAGGAACAGCGTCAACCTGCCTCATGGCAACTTCAACCTCGACCAGCTCACCGGCTACTTCGGCAGCCTCGGCCTCAGCCCCACCGACATGGTCGCCCTCTCCG
GTACGTTG
CCATGGCAGCAGCTACGTGCACAGCAATGGCGGCGGCGGCGACGCGTGTGATGTGACAACGATGTCTTGTGGAATTTGTTTTTCAGGGGGTCACACCATCGGGGCGGCGTCCTGCAGCTT
CTTCGGCTACAGGCTCGGCGGCGACCCGACCATGGACCCCAACTTCGCGGCGATGCTGCGCGGCAGCTGCGGCTCCAGCGGCTTCGCGTTCCTCGACGCCGCGACGCCGCTCCGGTTCGA
CAACGCCTTCTACCAGAACCTCCGCGCCGGCCGCGGCCTCCTCGGCTCCGACCAGACGCTCTACTCCGACCCGAGGTCCCGCGGCCTCGTCGACCGCTACGCCGCCAACCAGGGCGCCTT
CTTCAACGACTTCGTCGCCGCCATGACCAAGCTCGGCAGGGTCGGCGTCAAGTCGCCGGCCACCGGCGGCGAGATCCGCCGCGACTGCAGGTTCCCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGCTTCCATTTCGTCGTCGTCCTCGCGCTGGCGGTGGCGATCTCGTCGCCATTGGCGGTGGCGCAGCTGAAGCAGAACTACTACGCCAGCATCTGCCCGAACCTCGAGAACATC
GTGCGCGGGTCCGTGCAGAGGTCGATGCAGCAGTCGCCGATCGCGGCGCCGGCGACGCTGAGGCTCTTCTTCCACGACTGCGCCGTCCGCGGGTGCGACGCGTCGGTCATGATCATCAAC
CCGAACGGCGACGACGAGTGGAGGAACCCCGACGACCAGACGCTGAAGCCGGAGGGGTTCACGACGGTGATAGCCGCCAAGGCCGCCGTCGACAGCGACCCCCAATGCCGGAACAGGGTG
TCCTGCGCCGACATCTTGGCCCTCGCCACTAGAGACTCCGTCTTCCTG
AGTGGAGGACCGGACTACGCGGTGGAGCTCGGCAGGTTCGACGGCAGGGTGTCGACCAGGAACAGCGTCAAC
CTGCCTCATGGCAACTTCAACCTCGACCAGCTCACCGGCTACTTCGGCAGCCTCGGCCTCAGCCCCACCGACATGGTCGCCCTCTCCG
GGGGTCACACCATCGGGGCGGCGTCCTGCAGC
TTCTTCGGCTACAGGCTCGGCGGCGACCCGACCATGGACCCCAACTTCGCGGCGATGCTGCGCGGCAGCTGCGGCTCCAGCGGCTTCGCGTTCCTCGACGCCGCGACGCCGCTCCGGTTC
GACAACGCCTTCTACCAGAACCTCCGCGCCGGCCGCGGCCTCCTCGGCTCCGACCAGACGCTCTACTCCGACCCGAGGTCCCGCGGCCTCGTCGACCGCTACGCCGCCAACCAGGGCGCC
TTCTTCAACGACTTCGTCGCCGCCATGACCAAGCTCGGCAGGGTCGGCGTCAAGTCGCCGGCCACCGGCGGCGAGATCCGCCGCGACTGCAGGTTCCCCAACTGA

Retrieve as FASTA