Entry information : EglKat[P]05
Entry ID 11021
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EglKat[P]05
Name EglKat[P]05
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglKat[P]05
start..stop
S start..stop
EgrKat[P]05 622 0 1..310 1..321
EguKat[P]05 575 0 1..310 1..321
EcamKat03 507 0 1..310 137..466
EgrKat03 506 1e-180 1..310 141..470
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..589 589 N° 2 623..698 76 N° 3 1007..1122 116 N° 4 1298..1359 62
N° 5 1443..1527 85  
join(1..589,623..698,1007..1122,1298..1359,1443..1527)


exon

Literature and cross-references EglKat[P]05
Protein sequence: EglKat[P]05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308
PWM (Da):   %s   34850.7  
PI (pH):   %s   8.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PVFFIRDGKPNPKSHVQENWRILDVLAHHPESLGMFTLLFDDTGIPQDERNMTGSGVNTYALINKARKAHYVKFHWKQTCGVKSLLEEEAIRVGGSKHSLATRDLYDSIAAGNYLEWKLFVQIMDTDYKDKFDFDPLDVAKTWPKDILPPxMLVGRLVLNKNxxxxxAEN*QLAFCPSIVVPGVYYSDDKLLQVRIFPNYLQLPSNAPKCAHHYSHHEGFMNCLISLLQINYFPSRYDPVRHAERYPIPTAMLTGKREKGMIEKENNFKQPGERYRSRAPDRQEQFIC*WIDALSEPRMTHKIHSIWISY

Retrieve as FASTA  
Remarks Pseudogene from NGS. 5' and PS are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCGTCTTCTTTATCCGTGATGGGAAACCAAACCCCAAATCCCACGTCCAGGAGAACTGGAGGATCCTAGACGTTCTCGCCCACCATCCGGAGAGCTTGGGCATGTTCACCCTCCTCTTT
GATGATACTGGTATTCCACAAGATGAGAGGAACATGACGGGCTCTGGAGTTAACACCTACGCTTTGATCAACAAGGCCAGAAAAGCGCATTATGTGAAGTTTCACTGGAAACAAACTTGC
GGGGTCAAGAGCTTACTGGAGGAAGAGGCGATTAGAGTCGGGGGATCCAAGCACAGCCTTGCGACTCGGGATCTTTATGATTCCATTGCTGCTGGAAACTATCTTGAATGGAAACTTTTC
GTTCAGATCATGGATACTGATTATAAAGACAAATTTGACTTTGACCCGCTTGATGTGGCTAAGACCTGGCCCAAAGACATATTGCCCCCTANNATGCTAGTTGGCCGCTTGGTCTTGAAT
AAGAACNNNNNNNNNNNNNTTGCTGAGAATTAACAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGCGTCTACTACTCAGATGATAAGCTGCTCCAAGTTCGTATTT
TCTNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNACCAAATTATCTTCAACTCCCTTCTAATGCTCCTAAATGCGCTCATCACTACAGTCACCACGAAGGTTTCATGAATTGCCATGCATAGGATGAAGAG
GTAAGAATTTTCTTTGAATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAACCAAGTTAGACATCACGCTCTCCTATAAGTATGAAGGCCTAGTGATGC
ATTCTGACATGTCAATTGTGGATCCCAAAGTGGCGGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCCTTTGTGCCTGAAACATGCATGTTTACATATGTA
GGAAATACCTTTCTGCTATCACGTAAAATGATTATCTGTTGAGCAAATGTTTAATTTCCCTTTTGCAGATAAACTATTTTCCTTCAAGGTATGATCCCGTTCGTCATGCGGAGAGATATC
CCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAAGGTA
TGTTTTGTAGGATCTCTTTTACTTGGATAGAGATTGATTGTCCTGAGGTGCTTTCATGGTGATATCCATGGGATATAC
TCAACTTGTCCTAGATGATCAATTGAATTGCAGCGAGTGGTATGACTGATGTATGTGTGTTTGGATCTTGTTATCTTTTGTTTCTCCTGGCAGACCAACATTGAGAAAGAGAACAACTTC
AAGCAGCCTGGAGAGAGATACCGATCAAGGGCGCCTGAC
AGGTATTCTTCAGTTGTGCATCTCCTGAAAATGGTTTGATTGTCTCATGTTTCTCAATAATCTGTCTCTATCTTTCTTTTC
TCAGGCAAGAGCAGTTCATCTGCTGATGGATCGATGCTTTGTCTGAACCACGTATGACTCATAAGATCCACAGCATCTGGATTTCAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCGTCTTCTTTATCCGTGATGGGAAACCAAACCCCAAATCCCACGTCCAGGAGAACTGGAGGATCCTAGACGTTCTCGCCCACCATCCGGAGAGCTTGGGCATGTTCACCCTCCTCTTT
GATGATACTGGTATTCCACAAGATGAGAGGAACATGACGGGCTCTGGAGTTAACACCTACGCTTTGATCAACAAGGCCAGAAAAGCGCATTATGTGAAGTTTCACTGGAAACAAACTTGC
GGGGTCAAGAGCTTACTGGAGGAAGAGGCGATTAGAGTCGGGGGATCCAAGCACAGCCTTGCGACTCGGGATCTTTATGATTCCATTGCTGCTGGAAACTATCTTGAATGGAAACTTTTC
GTTCAGATCATGGATACTGATTATAAAGACAAATTTGACTTTGACCCGCTTGATGTGGCTAAGACCTGGCCCAAAGACATATTGCCCCCTANNATGCTAGTTGGCCGCTTGGTCTTGAAT
AAGAACNNNNNNNNNNNNNTTGCTGAGAATTAACAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGCGTCTACTACTCAGATGATAAGCTGCTCCAAGTTCGTATTT
NACCAAATTAT
CTTCAACTCCCTTCTAATGCTCCTAAATGCGCTCATCACTACAGTCACCACGAAGGTTTCATGAA
ATGTTTAATTTCCCTTTTGCAGATAAACTATTTTCCTTCAAGGTATGATCCCGTT
CGTCATGCGGAGAGATATCCCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAAGGTA
ACATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCAAGGGCGCCT
GAC
AGGCAAGAGCAGTTCATCTGCTGATGGATCGATGCTTTGTCTGAACCACGTATGACTCATAAGATCCACAGCATCTGGATTTCAT

Retrieve as FASTA