Entry information : EglKat[P]07
Entry ID 11023
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EglKat[P]07
Name EglKat[P]07
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglKat[P]07
start..stop
S start..stop
EgrKat[P]07 369 2e-133 1..177 1..177
EguKat[P]07 348 2e-125 1..177 1..177
EgrKat[P]05 340 6e-120 6..177 150..321
EguKat[P]05 338 3e-119 6..177 150..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..268 268 N° 2 578..693 116 N° 3 869..930 62 N° 4 1014..1098 85
join(1..268,578..693,869..930,1014..1098)


exon

Literature and cross-references EglKat[P]07
Protein sequence: EglKat[P]07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   177
PWM (Da):   %s   20525.27  
PI (pH):   %s   8.47
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PKTYCPLMLVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQIRIFSYSDAQRDRLAPNYLQLPSNAPKCAHHSSHHEGFMNCLISLLQINYFPSSYNPVHHAERYPIPTAMLTGKREKGMIEKENNFKQPGERYRSRAPDRQERFICRWIDALSEPRMTHEIHSIWISY

Retrieve as FASTA  
Remarks Pseudogene sequence from NGS. Two ends are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGAAGACATATTGCCCCCTAATGCTAGTTGGCCGCTTGGTCTTGAATAAGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGCGTC
TACTACTCAGACGATAAGCTGCTCCAAATTCGTATTTTCTCATATTCTGATGCTCAGAGGGACCGCCTTGCACCAAATTATCTTCAACTCCCTTCTAATGCTCCTAAATGCGCTCATCAC
AGCAGTCACCATGAAGGTTTCATGAATT
GCCATGCATAGGATGAAGAGGTAAGAATTTTCTTTGAATCCTTCCTCAGCAATACTCTGGGCAGCATCTCTTGTGGATTTTTTGTTGATGTA
ACCAAGTTAGACATCACGCTCTCCTATAGAACCCTCCTTTTGTTGGAGGATTACTTTCTTGATTTTTCTACTGCCCTTTGTGCCTGAAACATGCATGTTTACATATGTAGGAAATACCTT
TCTGCTATCATGTAAAATGATTATCTGTTGAGCAAATGTTTAATTTCCCTTTTGCAGATAAACTATTTTCCTTCAAGTTATAATCCCGTTCATCATGCGGAGAGATATCCCATTCCAACT
GCTATGCTGACTGGAAAGCGTGAAAAAGGTATGTTTTGTAGGATCTCTTTTACTTGGATAGAGATTGATTGTCCTGAGGTGCTTTCATGGTGA
TATCNNTGGGATATACTCAACTTGTCC
TAGATGATCAATTGAATTGCAGTGAGTGGTATGACTGATGTATGTGTGTTTGGATCTTGTTATCTTTTGTTTCTCCTGGCAGACCAACATTGAGAAAGAGAACAACTTCAAGCAGCCTGG
AGAGAGATACCGATCAAGGGCGCCTGACAGGTNNNNNNNNNNNNNNNATCTCCTGAAAATGGTTTGATTGTCTCATGTTTCTCAATAATCTGTCTCTATCTTTCTTTTCTCAGGCAAGAG
CGGTTCATCTGCCGATGGATCGATGCTTTGTCTGAACCACGTATGACTCATGAGATCCACAGCATCTGGATTTCATAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGAAGACATATTGCCCCCTAATGCTAGTTGGCCGCTTGGTCTTGAATAAGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGCGTC
TACTACTCAGACGATAAGCTGCTCCAAATTCGTATTTTCTCATATTCTGATGCTCAGAGGGACCGCCTTGCACCAAATTATCTTCAACTCCCTTCTAATGCTCCTAAATGCGCTCATCAC
AGCAGTCACCATGAAGGTTTCATGAATT
CGGAGAGATATCCCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAAGGTATGTTTTGTAGGATCTCTTTTACTTGGATAGAGATTGAT
TGTCCTGAGGTGCTTTCATGGTGA
AGGTNNNNNNNNNNNNNNNATCTCCTGAAAATGGTTTGATTGTCTCATGTTTCTCAATAATCGATCCACAGCATCTGGATTTCATAT

Retrieve as FASTA