Entry information : EglKat[P]12
Entry ID 11028
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EglKat[P]12
Name EglKat[P]12
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglKat[P]12
start..stop
S start..stop
EcamKat[P]12 220 2e-75 1..126 2..151
EguKat[P]12 182 2e-59 1..125 2..123
EguKat[P]12 45 0.000001 103..126 190..213
EcamKat[P]11 172 2e-57 1..101 2..102
EcamKat[P]06 176 4e-57 1..108 2..109
EcamKat[P]06 44 0.000002 100..122 198..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..304 304 N° 2 1071..1142 72  
join(1..304,1071..1142)


exon

Literature and cross-references EglKat[P]12
Protein sequence: EglKat[P]12
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   125
PWM (Da):   %s   13580.07  
PI (pH):   %s   8.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TIIYVIGPILLDDYHLMEKLANFDRERIxxxxxxARGACAKRFFEVTHDISHLTHADFLQAPGVQTPVTVRFSILIHERGGPETLRDPRGSPVNFYTR*VRVQAIIEKENNFKQLGERCRSWAPDR

Retrieve as FASTA  
Remarks Pseudogene from NGS. Short PS with gaps and stops in it.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTATCATCTACGTCATAGGTCCAATTCTTCTTGACGATTATCACCTCATGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTNNNNNNNNNNNNNNATNNGCCAGGGGAGCCTGTGCA
AAGCGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCATGCCGATTTCCTTCAGGCACCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCCACGAAAGGGGC
GGCCCTGAAACCCTGAGGGACCCCCGGGGTTCTCCTGTGAACTTCTACACAAGATAGGTGAGGG
TCGTTTTGGTAGTAGACATGAATGTGCAGTATGGACGGGCATGAGTATGATGCTCC
CTGTGANNNNNNNNNTTCACGGGTGGCCTAAACTCGACGGATGCATATGGCAGTTCTCTTGTCCACATTGCATACATTTGTTTTGTTGCACTTTGCTATGTGATCTTACCTTTTCNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCTGGGCAGCATCTCTTGTGGATTTTTTGTTGATGTAACTAGACATCGTGCTTTCCTATAAGCATGTAGG
CGTTGTGATGCAATCTGACATGTCAATTGCGGATCCTAAAGTGGCAGTGCGAATGTCCTCCCTCCTTTTGAGGAAGATTACTTTCTTAATTTTGCAAATGCACTTTGTACCTGAAACATA
CATACATGTTTACATATGTAGGAAATGCCTGTCTGCTATCATGTAAAATGATTATCTGTTGAGCAAATGCTTAATTTCCCTGTTGCAGATAAACTATTTTCCGTCAAGGTATGATCCTGT
TCGTCATGCAGAGAGATATCCTATTCCACCTGCTATGCTGACTGGAAAGCGTTAAAAGGTGTGTTTTTAATTAGTATCTCTTTTACGTAAACAGAGATTGATTGTCTTGAGGTGCTTTCA
TGGTAAAATCCATGGTATAGACTCAGCTTGTCCTAGATGGTCAATTGAATTGCAGTGAGTAGTGTGATTGATGTATGTGTGTTTGGATTTTGTTTACTTTTGTTGCTCCAAACAGGCCAT
CATTGAGAAAGAGAACAACTTCAAGCAGCTCGGAGAGAGATGCCGATCATGGGCACCTGACA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTATCATCTACGTCATAGGTCCAATTCTTCTTGACGATTATCACCTCATGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTNNNNNNNNNNNNNNATNNGCCAGGGGAGCCTGTGCA
AAGCGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCATGCCGATTTCCTTCAGGCACCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCCACGAAAGGGGC
GGCCCTGAAACCCTGAGGGACCCCCGGGGTTCTCCTGTGAACTTCTACACAAGATAGGTGAGGG
AACAGGCCATCATTGAGAAAGAGAACAACTTCAAGCAGCTCGGAGAGAGATGCCGA
TCATGGGCACCTGACA

Retrieve as FASTA