Entry information : EglKat[P]13
Entry ID 11029
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EglKat[P]13
Name EglKat[P]13
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglKat[P]13
start..stop
S start..stop
EcamKat13 170 2e-57 1..84 2..85
EgrKat03 171 3e-53 1..84 391..474
EcamKat03 171 3e-53 1..84 387..470
EgrKat[P]07 157 2e-51 1..85 98..182
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..87 87 N° 2 265..332 68 N° 3 415..517 103  
join(1..87,265..332,415..517)


exon

Literature and cross-references EglKat[P]13
Protein sequence: EglKat[P]13
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   85
PWM (Da):   %s   10007.08  
PI (pH):   %s   9.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
NYFPSRYDPVRHAERYPIPTAMLTGKREKTIIEKENNFKQPGERYRSxxPDRQERFICRWIDALSDPRVTHEIRSVWISYWSQVR

Retrieve as FASTA  
Remarks Pseudogene from NGS. Short PS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTATTTTCCATCAAGGTACGATCCTGTTCGTCATGCAGAGAGATATCCCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAGGTTTGTTTCCTAGGATCTCTTTTACTTGAACAG
AAATTGGTTGTCTTGAGGTGCTTTCATGGTGATATTGATGGGATAGACTCAGCTTGTCCAGTAGATAATCAATTGAATTGCAGTTAGTTGTGTGACTAGATGTATGTGTGTTTGGATTTT
GTTAACTTTTGTTGCTCCAAACAGACCATCATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCNNNNNCACCTGACAGGTATCCTTCAGTTGTGCATATCCTGATA
ATGGTTTGATGGTCTCATGTTTCTCAATCATTTGTCTCTATCTTCTTTTTTCAGGCAAGAGCGGTTCATCTGCCGATGGATCGATGCTTTGTCTGACCCACGCGTGACTCATGAGATCCG
CAGCGTCTGGATTTCATACTGGTCTCAGGTGAGATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTATTTTCCATCAAGGTACGATCCTGTTCGTCATGCAGAGAGATATCCCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAGACCATCATTGAGAAAGAGAACAACTTCAAGCAG
CCTGGAGAGAGATACCGATCNNNNNCACCTGACAG
GCAAGAGCGGTTCATCTGCCGATGGATCGATGCTTTGTCTGACCCACGCGTGACTCATGAGATCCGCAGCGTCTGGATTTCATAC
TGGTCTCAGGTGAGATAG

Retrieve as FASTA