Entry information : OsPrx93
Entry ID 1103
Creation 2005-07-21 (Filippo Passardi)
Last sequence changes 2005-07-21 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx93
Name OsPrx93
Class Class III peroxidase    [Orthogroup: Prx123]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx93
start..stop
S start..stop
OsPrx92 624 0 1..314 1..314
OsPrx91 453 2e-162 6..314 10..319
SiPrx44 450 4e-161 1..314 2..320
BdiPrx21 449 9e-161 24..314 24..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28638101..28638508 408 N° 2 28638959..28639118 160 N° 3 28639213..28639589 377  
join(28638101..28638508,28638959..28639118,28639213..28639589)


exon

Literature and cross-references OsPrx93
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1K0
DNA ref. GenBank:   NC_008399.1 (28638101..28639586)
Protein sequence: OsPrx93
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (292)
PWM (Da):   %s   33707.73 (31353.4)  
PI (pH):   %s   8.39 (8.20) Peptide Signal:   %s   cut: 23 range:23-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSFHFLVVLALAMAISSPLVAANLRKNYYAKICPNLENIVRGSVQRSMQQSPIAAPATLRLFFHDCAVRGCDASIMIINPNGDDEWRNPDDQTLKPEGFTTVIAAKAAVDSDPQCRNRVSCADILALATRDSIFLSGGPNYAVELGRFDGRVSTRNSVNLPHGNFNLDQLTGYFGSLGLSPTDMVALSGGHTIGAASCNFFGYRLGGDPTMDPNFAAMLRGSCGSSGFAFLDAATPLRFDNAFYQNLRAGRGLLGSDQTLYSDPRSRGLVDRYAANQGAFFNDFVAAMTKLGRVGVKSPATGGEIRRDCRFPN

Retrieve as FASTA  
Remarks chromosome 6. No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGCTTCCATTTCCTCGTCGTCCTCGCGCTGGCGATGGCGATCTCGTCGCCATTGGTGGCGGCGAACCTGAGGAAGAACTACTACGCCAAGATCTGCCCGAACCTCGAGAACATC
GTGCGCGGGTCCGTGCAGAGGTCGATGCAGCAGTCGCCGATCGCGGCGCCGGCGACGCTGAGGCTCTTCTTCCACGACTGCGCCGTCCGCGGGTGCGACGCGTCGATCATGATCATCAAC
CCGAACGGCGACGACGAGTGGAGGAACCCCGACGACCAGACGCTGAAGCCGGAGGGGTTCACGACGGTGATAGCCGCCAAGGCCGCCGTCGACAGCGACCCCCAGTGCCGGAACAGGGTG
TCCTGCGCCGACATCTTGGCCCTCGCCACCAGAGACTCCATCTTCCTG
GTAACTCACACTCACTTGCCTGTATCTACCCTACCTTACCGGCCCATTTTTGCGCGGTATCGAGTTACAATC
TAAAAGCCTAAGTTGATGAGAAAAAACGAATAATTCACTTTATATTCCAACACGCACAAATGGTTCTGGAATTCATTCTCTCGGAGGGCCGTATGTGGTCTTCCGCTGATGTTGCTATTT
TGAGGGGTTTGTTGGTAGTGTAGTGTGGCTCTGCCCTCCTTTCCGCTGATTGGAGTTCCGTTTAGCTGCCACAGTAGTTTTTCTTTTTCCTAGCTACAGTTTTTGTTTTGCTTTTTCTTT
CTTCTTTTAACATAGGTCTGTCTGACCAATTACGTTGTGTAGAAAAAAAACTCTTCTCCTTCCAATATATTGACGTGCAATCTTTTTGCGCGTTCGTGAAAAAAGAATGGCCATTGATGG
CTTGGCTGCATGATGCAGAGTGGAGGGCCGAACTACGCGGTGGAGCTCGGCAGGTTCGACGGCAGGGTGTCGACCAGGAACAGCGTCAACCTGCCTCATGGCAACTTCAACCTCGACCAG
CTCACCGGCTACTTCGGCAGCCTCGGCCTCAGCCCCACCGACATGGTCGCCCTCTCCG
GTACGTTGCCATGGCAGCAGCTACATGCACAGCAATGGCGGCGGCGGCGACGCGTGTGATGT
GACAACGATGTCTTGTCGAATTTGTTTTTCAGGGGGTCACACCATCGGGGCGGCGTCGTGCAACTTCTTCGGCTACAGGCTCGGCGGCGACCCGACCATGGACCCCAACTTCGCGGCGAT
GCTGCGCGGCAGCTGCGGCTCCAGCGGCTTCGCGTTCCTCGACGCCGCGACGCCGCTCCGGTTCGACAACGCCTTCTACCAGAACCTCCGCGCCGGCCGCGGCCTCCTCGGCTCCGACCA
GACGCTCTACTCCGACCCGAGGTCCCGCGGCCTCGTCGACCGCTACGCCGCCAACCAGGGCGCCTTCTTCAACGACTTCGTCGCCGCCATGACCAAGCTCGGCAGGGTCGGCGTCAAGTC
GCCGGCCACCGGCGGCGAGATCCGCCGCGACTGCAGGTTCCCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGCTTCCATTTCCTCGTCGTCCTCGCGCTGGCGATGGCGATCTCGTCGCCATTGGTGGCGGCGAACCTGAGGAAGAACTACTACGCCAAGATCTGCCCGAACCTCGAGAACATC
GTGCGCGGGTCCGTGCAGAGGTCGATGCAGCAGTCGCCGATCGCGGCGCCGGCGACGCTGAGGCTCTTCTTCCACGACTGCGCCGTCCGCGGGTGCGACGCGTCGATCATGATCATCAAC
CCGAACGGCGACGACGAGTGGAGGAACCCCGACGACCAGACGCTGAAGCCGGAGGGGTTCACGACGGTGATAGCCGCCAAGGCCGCCGTCGACAGCGACCCCCAGTGCCGGAACAGGGTG
TCCTGCGCCGACATCTTGGCCCTCGCCACCAGAGACTCCATCTTCCTG
AGTGGAGGGCCGAACTACGCGGTGGAGCTCGGCAGGTTCGACGGCAGGGTGTCGACCAGGAACAGCGTCAAC
CTGCCTCATGGCAACTTCAACCTCGACCAGCTCACCGGCTACTTCGGCAGCCTCGGCCTCAGCCCCACCGACATGGTCGCCCTCTCCG
GGGGTCACACCATCGGGGCGGCGTCGTGCAAC
TTCTTCGGCTACAGGCTCGGCGGCGACCCGACCATGGACCCCAACTTCGCGGCGATGCTGCGCGGCAGCTGCGGCTCCAGCGGCTTCGCGTTCCTCGACGCCGCGACGCCGCTCCGGTTC
GACAACGCCTTCTACCAGAACCTCCGCGCCGGCCGCGGCCTCCTCGGCTCCGACCAGACGCTCTACTCCGACCCGAGGTCCCGCGGCCTCGTCGACCGCTACGCCGCCAACCAGGGCGCC
TTCTTCAACGACTTCGTCGCCGCCATGACCAAGCTCGGCAGGGTCGGCGTCAAGTCGCCGGCCACCGGCGGCGAGATCCGCCGCGACTGCAGGTTCCCCAACTGA

Retrieve as FASTA