Entry information : EglDiOx01
Entry ID 11042
Creation 2012-05-21 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-23 (Christophe Dunand)
Peroxidase information: EglDiOx01
Name EglDiOx01
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglDiOx01
start..stop
S start..stop
EcamDiOx01 1296 0 1..629 1..628
EgrDiOx01 1294 0 1..629 1..628
EguDiOx01 1285 0 1..629 1..628
PtDiOx02 1084 0 1..629 1..628
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..93 93 N° 2 189..457 269 N° 3 1401..1545 145 N° 4 1734..1867 134
N° 5 2555..2768 214 N° 6 3187..3332 146 N° 7 3460..3687 228 N° 8 3886..4088 203
N° 9 4172..4415 244 N° 10 4535..4745 211  
join(1..93,189..457,1401..1545,1734..1867,2555..2768,3187..3332,3460..3687,3886. .4088,4172..4415,4535..4745)


exon

Literature and cross-references EglDiOx01
Protein sequence: EglDiOx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   629
PWM (Da):   %s   72113.7  
PI (pH):   %s   8.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALISVFSSLIHPQLRPMVSKMSLFDALIFLVIHAVDKLGLWHRLPVYMGLAYVGMRRHLHQRYNLIHVGSVDGKKYDTQAFNYRTADGRCNHPSDDVVGSRGTFFGRNMPPSTSTYGVSMDPHPSVVASKLLARKEFIDNGKQFNMIACSWIQFMIHDWVDHMEETDVEIEAPDEVAEKCPLKSFRFNKTKKVSTGSSHLKNGSLNIRTPWWDGSVIYGNDDNGERRVRTFKDGKLKISGDGLLEHDEKGIPISGDVRNSWAGFSLLQALFVKEHNTVCDMLKYYPDLDDEKLYRHARLVTSAVIAKIHTIDWTVELLKTDTLLAGMRINWYGFLGKKFKDMFGHICGPILSGLVGLKRPRDHGVPYSLSEEFVSVYRMHSLLPDKLILRDINSTILEHKCLPVAEEIPMREVVGRQGQRRLSKIGMEQMMVSLGHQACGALSLWNYPSWMRNLVPQDVDGEDRPDSIDMAALIYRDRERGIARYNEFRRNMLMIPISRWEDLTDDKQVIRALREVYGDDVEKLDLLVGLHAEKKIKGFAISETAFFIFLLIASRRLEADRFFTTNFNTQTYTEKGLEWVNRTETLKDVIDRHFPDMTRKYMRCSSAFAVWDSQPTPTSHIPLY

Retrieve as FASTA  
Remarks Complete sequence from NGS. Some NNNN in intron.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTTGTACGTAACTCCCTCTCCCACAAAAAG
ATGAGAGATGTGGTCGACGAGTGATCTGGCTTTTGATTTCTTACTGTTGTTTTGGGTGTTTCGTGTAGGTGATACATGCGGTGGACAAGCTAGGATTATGGCACAGACTGCCGGTGTACA
TGGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAGAAGTATGATACTCAGGCATTCAACTATCGGACGGCGGACG
GAAGGTGCAACCACCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTTTTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGGGTAAGCAT
GTATTATAGGTCTTCTGATTTAC
TCAGTTTATCAAATCAGAGAGGTTGAGTTTACGTTTATCTGTTTCTTCTTCTTAAAATCAGAAGTTTACATTACTTTAAAAAGAACAGGCAACTGATAAAACTGTCCTTAATGCTCATTT
GCGACGGCTTACTAGGCGTCGCCTGTGTCACCCGTATACTTTCTTAATTGGAGCTACTGACGGTCCAGCGAGCCGGTCGACACCAGTGACTGCTATCGGAGCCGTCCCTAAAAGCCGCAT
TAGGGGCAGTTTTCCTGTCCCTAAACTCGCTTGAGAATAATATCCATAAAAGAGCTACTTTTTTTCTGTCTTTTCCCGGTGGGGAGAGCAAAAACGTGCAAAGCTTTGATCATAGAAAGA
CACCAATTCGATGACAATTATTCTCTCTAGTGTAGGAAGATTTATTAAAATTTCAAGTTAAAGGATGAAATTTTTCTTTTTTTATTGAAAAAAACTAAAGTAAATTTTCTATCAGATCGG
AGAAGATGAAAATGCAACTTCAGAAAGTTACCCAACCACAAGCCATTAAAGAATTCCAGCAGTCTCTACTTTAGGTTTCTATCAATGGCCCACAGTCAAAATCTACATATGGACTGCCAT
GGCTGGTCAGAAAAAAAATTCCACTTCCCAAGGGCCTCATTCTCTTCATTTGGTTTACCATTAATTTACTCAACTCATTAAGTGGGAGGCAGGCTATGGCCCTGTCACACCGCCCATGTC
CACGGATTAGATTTGTTCAGTTTCTGTCTGAAATGGCCTACAAATTTCATGAACTTGATTCTATCTCCGCTTGGAGAACAGCTGTCCAGTCTTATCTGTCAATCGTAAAGATTATTGTCT
TCTGATCGAATACCAAGTACAAGCATAGCCTGCAATACCAACAAAACTAATTTTGATCGTCTTCTTTTTCCACAGTTAATGGATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCA
AGAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGGGTTGATCACATGGAGGAAACTGATCAG
GTACTAGATACAACA
AAANNNNNNNAAAAGTCCCCATAGCCTCTGTATTATACAAGGCACAGCTTGATATTTTGTAGGAAAACAACCTCATAATATTTTTGACAAACTCAAAATGGAGAAGTAGCCGAATGGATC
CACCAGTTGGGTCATCGCATTGAAGACTGAATGATCAATAATATCTTCGGCAGGTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGA
CCAAGAAAGTGTCAACTGGGTCATCTCATTTGAAGAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GTAAGTTCCTGCGAACAGTATTGTAATTACTCAGGACTACTAAACTTTAGGCA
GCCATTCAAAAAACTCATGTCACTGAAAACAAGTATTTGCAGCCATCTGATTCATGATCCTTTTACGAGTTGAATGCAGAAAAAGATGGTGAAGAAAGATTTGGAAAAAAGATTAAGAAG
CAATGTTGTAGACAATATTTCAACCTCGCTGAGCCATAAGACTTGGAATTCCCTGCTTTTTGCCTTCACCACCTGAACAAACTGAGAACTATGAACTTTCGTTATGCTGTCACCAGACAG
ATGTCCATATTTGTTCTCAGTTTGTTCTTAGATGCTGGAGAGTTCCTCAATAAAATGGAATATGGCCTGGATAGAATAGTACTCTGAGGAAACTATGGAAACTACATACAGATATTCCAA
AATTTCGTTTATATACGCTAAAATTTGCTTACATGTAGGGTTTCATCTAAAATTGATGTCACTATGAAGTCTAGTACTTCCAGTAAGGCAACTAAGCCAATGACTTAAGGTGTGATTTCA
TCTCAAAAGAAAAAAAGGTGGCTATCTCAGTAATGATTAGCTGATCTTAGTCAAAACCTCACCAGTTAACTTGTTACTGCTCTAAGAGTTTTCTCGAAGAATTGACATGAAGATGTGAAT
TTCATCAATGAGTTGTACATTGTAAACTGCTTAGGGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAGAGTGAGGACCTTCAAAGATGGGAAGCTAAAGATTTCGGGAG
ATGGCCTCCTTGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCGTCAAAGAACACAACACTGTCTGCGATA
TGCTTAAA
GTAAGGCCTCCCTTCTCTTCCACCAATCCAATGAAAAGAACTTCCTTATTAAACAATGCTGATCCCGAGTTTTCGATCGAGATCTGGTGAAATGTCCATGACCTCCTGATAT
CGTTGTTTCCAAATTCTTCAAGTCTATAAGGGCCGACACTTCTCTCGTCATTGTTATTTGCTTGGACGAAAAGTTAGCTCTGAATACAACTGCACATCTTTTACCTGAGGAACTATTATA
GAACAAAGAAGCCTGACATCTTTGATCATCGTCAGAACCATATCTCATATAATTACCCTGGCTTCATGCGTGCTATCCTTAGGGTTGAGCGGTATCAACATAACATTTCATTGAAAAAAT
TGCCGGCACTCATATACCAAAGAAACTACAAGGATAGCTAATATTATGTACTTGTATATGTGTCAGAAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCATGCCAGATTAGTA
ACTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTCCTGAAGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTAATAAAGAGAGAAAAATGGATCTGAT
GATGAACGACTGGGGATTTACTAGTAGTAGTTCTAAAACTAACGCATAATTCTGTGATAATGCTGTACTTACTACTTACCACTATCATGCCTGGTTCAGGTACGGATTTCTGGGGAAGAA
ATTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTCAAAAGGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGTCAGCGTCTATAG
GATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACATCAACTCAACTATCCTGGAACACAAATGTCTGCCCGTTGCAGAAGA
GTAAGCATCTTACCATACCATTTGCATCTAATT
TCACTTTCTTCATGTTTGCTGTTACTGCCAAACTAAGGTCGCACTGACAAAAGCAAAGAACTTCGATCTCATGAAATAACAGATATATTGTCTTCTTCGGGAAATGGCTTTCAATTTTAC
TTCTAGAGGGACTACAGTCACTAATTGTTCTAGGAAAATTACTAGGATTCCGATGCGGGAAGTGGTGGGACGACAAGGGCAGAGAAGACTCTCAAAGATTGGAATGGAGCAGATGATGGT
GTCACTAGGTCATCAGGCATGTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCGAAGATAGACCCGACTCAATCGACATGGCAGC
ATTAGAAA
GTAACATGACTACTCACCTCATTTCTTTCGCACTGCTATATCAACGTGACTGCACTCGAACTGACGCTCGCATATTGGGCCAGTTTACAGAGACAGGGAGAGAGGTATCGCG
CGGTACAACGAGTTCAGAAGAAACATGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCAAGTTATTCGAGCCTTGCGAGAAGTCTATGGAGACGATGTGGAGAAG
CTTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGTGAAACTGCTTTCTTCATCTTTCTACTGATTGCATCCAG
GTACCTCTCATATCCCCAACCCAAT
TAGGATACCCTGGAAGTGTTGACCCTTAATTCCATAACGTCCTGGCTGTGCCTTCTAACTTCTTGAACCCTCGTTCTTGATAATTTTTTTCCAGGCGGCTAGAAGCCGACCGGTTCTTTA
CAACCAACTTCAACACACAGACATACACAGAGAAAGGCCTGGAATGGGTAAACAGGACGGAGACATTGAAGGACGTCATAGATCGTCACTTCCCCGATATGACGAGGAAGTATATGAGAT
GTTCAAGCGCATTCGCTGTATGGGATTCACAGCCAACGCCAACCTCACACATACCCCTCTATTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTTGTGATACATGCGGTGGACAAGCTAGGA
TTATGGCACAGACTGCCGGTGTACATGGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAGAAGTATGATACTCAG
GCATTCAACTATCGGACGGCGGACGGAAGGTGCAACCACCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTTTTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGGGTAAGC
AT
GGATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCAAGAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGG
GTTGATCACATGGAGGAAACTGATCAG
GTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGACCAAGAAAGTGTCAACTGGGTCATCT
CATTTGAAGAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAGAGTGAGGACCTTCAAAGATGGGAAGCTAAAGATT
TCGGGAGATGGCCTCCTTGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCGTCAAAGAACACAACACTGTC
TGCGATATGCTTAAA
AAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCATGCCAGATTAGTAACTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTC
CTGAAGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTACGGATTTCTGGGGAAGAAATTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTC
AAAAGGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGTCAGCGTCTATAGGATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACATCAACTCAACTATCCTG
GAACACAAATGTCTGCCCGTTGCAGAAGA
GATTCCGATGCGGGAAGTGGTGGGACGACAAGGGCAGAGAAGACTCTCAAAGATTGGAATGGAGCAGATGATGGTGTCACTAGGTCATCAG
GCATGTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCGAAGATAGACCCGACTCAATCGACATGGCAGCATTAGAAA
TTTACAGA
GACAGGGAGAGAGGTATCGCGCGGTACAACGAGTTCAGAAGAAACATGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCAAGTTATTCGAGCCTTGCGAGAAGTC
TATGGAGACGATGTGGAGAAGCTTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGTGAAACTGCTTTCTTCATCTTTCTACTGATTGCATCCAG
GCGG
CTAGAAGCCGACCGGTTCTTTACAACCAACTTCAACACACAGACATACACAGAGAAAGGCCTGGAATGGGTAAACAGGACGGAGACATTGAAGGACGTCATAGATCGTCACTTCCCCGAT
ATGACGAGGAAGTATATGAGATGTTCAAGCGCATTCGCTGTATGGGATTCACAGCCAACGCCAACCTCACACATACCCCTCTATTTG

Retrieve as FASTA