Entry information : CnGPx01_H99
Entry ID 11048
Creation 2012-05-21 (Catherine Mathe)
Last sequence changes 2012-05-21 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-08-23 (Catherine Mathe (Scipio))
Peroxidase information: CnGPx01_H99
Name CnGPx01_H99
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3007]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnGPx01_H99
start..stop
S start..stop
CnGPx01_JEC21 310 4e-111 1..151 1..151
CgaGPx01 308 2e-110 1..151 1..151
DcryGPx01 281 2e-99 1..151 1..151
TmesGPx01_Fries 255 2e-89 1..151 1..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 98657..98680 24 N° 2 98503..98584 82 N° 3 98348..98436 89 N° 4 98198..98284 87
N° 5 98039..98122 84 N° 6 97915..97980 66 N° 7 97821..97844 24  
complement(join(97821..97844,97915..97980,98039..98122,98198..98284,98348..98436 ,98503..98584,98657..98680))


exon

Literature and cross-references CnGPx01_H99
DNA ref. JGI genome:   cneoH99_Chr13 (98680..97821)
Protein sequence: CnGPx01_H99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   152
PWM (Da):   %s   16877.57  
PI (pH):   %s   5.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDIYSYSVEFPKSTLPLSDLKGKTLLFVNVASKCGLTPQYKDLQALHEKYGDKGLAIIGFPCNFKAQEPGTDDEVLQFCQLNYGVTFPIAKKGDVNGENTQPIWKYLKENAEPPVSDIDWNFSKFLVKDGKITWFPARSTKVSDVEAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Strain="H99", variety="grubii".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGATATCTACTCCTACTCTGTGAGTTTCCAGCGGTCCCAACTCTTTTCGTGTGCTTCTCCACCTAGATACCCGATTGACGGACACGAACAGGTTGAGTTTCCCAAGTCCACTCTT
CCCCTTAGTGACCTGAAGGGCAAGACTCTCTTGTTTGTCAATGTTGCGAGCAAGTGTG
GTTAGTTTAATTCTTTCCTGGGAAGTAATTTGCCGTTCACGGCTGATGAATTGTATTTTCCC
ATAGGTTTGACTCCTCAGTACAAGGATCTCCAAGCTTTGCACGAGAAGTATGGTGATAAGGGACTGGCAATCATTGGTTTCCCTTGCAACCAAGTAAGCGTGCCTGGTGGTTTGAAGTAA
AGAGGTGGCGGATGACTGATCCGTTTGCCGATGCAGTTTAAGGCTCAAGAGCCTGGGACCGATGATGAGGTTCTTCAATTCTGTCAACTCAACTATGGAGTGACTTTTCCTATTGCCAAG
AAG
GTATATATCTCTAAATTTTACGCTGGTAGTGGATGTGACGGAAAATATGTGCTGATTTATTTTTCTCCTTGACAGGGCGACGTTAATGGCGAAAACACTCAGCCTATCTGGAAATAC
CTCAAAGAGAACGCCGAGCCCCCTGTCTCTGACATCGACTGG
GTACGTCCATTTTTTACCTCAAGCAATTGAAGGGAGGCTGATAGTAACATATACTCAGAACTTTTCCAAGTTCCTTGT
CAAGGATGGAAAGATCACCTGGTTCCCTGCCCGAAGCACCAAGGTT
GTAAGTACCATCCCTCCAACCTTAGCTCCTCATGGTAGCTAAAACTGACCCGACACGTTTGTGGGTGCAGAGCG
ATGTTGAGGCTGCACTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGATATCTACTCCTACTCTGTTGAGTTTCCCAAGTCCACTCTTCCCCTTAGTGACCTGAAGGGCAAGACTCTCTTGTTTGTCAATGTTGCGAGCAAGTGTGGTTTGACTCCTCAG
TACAAGGATCTCCAAGCTTTGCACGAGAAGTATGGTGATAAGGGACTGGCAATCATTGGTTTCCCTTGCAACCAA
TTTAAGGCTCAAGAGCCTGGGACCGATGATGAGGTTCTTCAATTC
TGTCAACTCAACTATGGAGTGACTTTTCCTATTGCCAAGAAG
GGCGACGTTAATGGCGAAAACACTCAGCCTATCTGGAAATACCTCAAAGAGAACGCCGAGCCCCCTGTCTCTGACATC
GACTGG
AACTTTTCCAAGTTCCTTGTCAAGGATGGAAAGATCACCTGGTTCCCTGCCCGAAGCACCAAGGTTAGCGATGTTGAGGCTGCACTTTGA

Retrieve as FASTA