Entry information : Cn1CysPrx01_grubiiH99
Entry ID 11050
Creation 2012-05-21 (Catherine Mathe)
Last sequence changes 2012-05-21 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: Cn1CysPrx01_grubiiH99
Name Cn1CysPrx01_grubiiH99
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cn1CysPrx01_grubiiH99
start..stop
S start..stop
Cn1CysPrx01_JEC21 464 2e-169 1..233 1..233
Sre1CysPrx 286 6e-99 3..227 4..217
Um1CysPrx 285 8e-99 3..227 4..217
Pbl1CysPrx01 278 8e-96 1..226 1..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1508970..1509035 66 N° 2 1509122..1509461.. 340 N° 3 1509548..1509792 245 N° 4 1509842..1509892 51
join(1508970..1509035,1509122..1509461..,1509548..1509792,1509842..1509892)


exon

Literature and cross-references Cn1CysPrx01_grubiiH99
DNA ref. JGI genome:   cneoH99_Chr3 (1508970..150989)
Protein sequence: Cn1CysPrx01_grubiiH99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   234
PWM (Da):   %s   25900.38  
PI (pH):   %s   5.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRLGDIAPDFEADTTHGRIKFHDWLDGSWAILFSHPDDYTPVCTTELSAVALSYADFASRGVKLIGLSANNVASHEGWIKDINALNPDGPGLEFPIIGDEDRTVSELYGMLDKLDKTNVDKKGIPFTVRTVFVIDPKKQIRLTLAYPASTGRNFPEILRVIDSLQLGDKHRITTPANWGIPDPKTGQVEERVIVHPSVQGEEVKQLFGDDVQIVPYLRFTSNPSKKEVKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Strain="H99", variety="grubii".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCCGACTTGGTGATATTGCCCCCGATTTTGAGGCTGACACTACGCACGGCCGCATCAAGGTGAGTTCAAGTTGCCCCATTCCGTCTTTTCGTCTCTCTCTCTCTCTCCATATT
TGCTTTCTCGGTGTAACTAACTTTGGCGACAGTTCCACGACTGGCTCGACGGGTCGTGGGCCATCCTCTTCTCCCACCCTGACGACTACACTCCCGTCTGCACCACTGAACTCTCCGCCG
TTGCTCTCTCGTACGCCGATTTCGCCTCGCGGGGTGTCAAGCTCATCGGTCTTTCCGCCAACAATGTGGCCTCGCACGAAGGGTGGATCAAGGATATCAATGCCTTGAACCCTGATGGCC
CTGGATTGGAGTTTCCCATTATAGGAGATGAGGATAGGACAGTGTCAGAGTTGTATGGGATGTTGGATAAGCTTGATAAGACGAATGTGGATAAGAAGGGGATACCGTTTACGGTCAGGA
CTGTTTTCGTTA
GTAAGTATCATCACCAACAGATCAACATCCCCAATTTCTAATTTCTATATTTTATTGGCTTGTGCTGACAAATGTACCCGACATAGTCGACCCCAAGAAGCAGATCCG
TCTCACCCTCGCTTATCCCGCGTCTACAGGCCGCAACTTTCCCGAAATCTTGCGTGTCATTGACTCTCTCCAGCTTGGCGATAAACACCGTATCACCACCCCTGCCAACTGGGGGATTCC
TGATCCCAAGACTGGACAGGTCGAGGAGAGGGTTATCGTCCACCCTTCTGTACAGGGTGAGGAGGTGAAGCAGTTGTTTGGAGATGATGTTCAGATTGTCTAT
GTGAGTTATGGTCGTCC
CGCCTTGGGGCATTACTGATACTTTTTGGTAGCCTTACCTACGATTTACATCCAACCCTTCCAAGAAGGAGGTCAAGGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCCGACTTGGTGATATTGCCCCCGATTTTGAGGCTGACACTACGCACGGCCGCATCAAGTTCCACGACTGGCTCGACGGGTCGTGGGCCATCCTCTTCTCCCACCCTGACGAC
TACACTCCCGTCTGCACCACTGAACTCTCCGCCGTTGCTCTCTCGTACGCCGATTTCGCCTCGCGGGGTGTCAAGCTCATCGGTCTTTCCGCCAACAATGTGGCCTCGCACGAAGGGTGG
ATCAAGGATATCAATGCCTTGAACCCTGATGGCCCTGGATTGGAGTTTCCCATTATAGGAGATGAGGATAGGACAGTGTCAGAGTTGTATGGGATGTTGGATAAGCTTGATAAGACGAAT
GTGGATAAGAAGGGGATACCGTTTACGGTCAGGACTGTTTTCGTTA
TCGACCCCAAGAAGCAGATCCGTCTCACCCTCGCTTATCCCGCGTCTACAGGCCGCAACTTTCCCGAAATCTTG
CGTGTCATTGACTCTCTCCAGCTTGGCGATAAACACCGTATCACCACCCCTGCCAACTGGGGGATTCCTGATCCCAAGACTGGACAGGTCGAGGAGAGGGTTATCGTCCACCCTTCTGTA
CAGGGTGAGGAGGTGAAGCAGTTGTTTGGAGATGATGTTCAGATTGTCTAT
CCTTACCTACGATTTACATCCAACCCTTCCAAGAAGGAGGTCAAGGCTTAG

Retrieve as FASTA