Entry information : Cn2CysPrx01_H99
Entry ID 11051
Creation 2012-05-21 (Catherine Mathe)
Last sequence changes 2012-05-21 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-08-23 (Catherine Mathe (Scipio))
Peroxidase information: Cn2CysPrx01_H99
Name Cn2CysPrx01_H99
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cn2CysPrx01_H99
start..stop
S start..stop
Cn2CysPrx01_JEC21 404 2e-146 1..197 1..197
Slut2CysPrx01 255 1e-87 9..195 5..193
Sbre2CysPrx01 255 2e-87 9..195 5..193
Athi2CysPrx01 254 3e-87 9..195 5..193
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1078433..1078473 41 N° 2 1078622..1078693 72 N° 3 1078757..1078781 25 N° 4 1078859..1078868 10
N° 5 1078928..1079094 167 N° 6 1079151..1079429 279  
join(1078433..1078473,1078622..1078693,1078757..1078781,1078859..1078868,1078928 ..1079094,1079151..1079429)


exon

Literature and cross-references Cn2CysPrx01_H99
DNA ref. JGI genome:   cneoH99_Chr8 (1078433..1079429)
EST ref. GenBank:   GD278843.1 [5' end]   GD277750.1 [3' end]
Protein sequence: Cn2CysPrx01_H99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198
PWM (Da):   %s   21602.91  
PI (pH):   %s   4.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATYALPQIQKPAPNFAGTAVKEGSFEEIKLDDFKGKWTVLVFYPDFTFVCPTEILAFNKALDQFAAIGAEVICVSTDSEFTHLAWSQTKRSEGGLGPDLKLTLADRNHAAAKAYGVLLPEEGVALRGTFFIDPKGTLRAMHVHDLPVGRSVEETIRVIKAFQFTDEHGEVCPAGWEEGKDTIDTSAPSAYFSKQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 7 ESTs (confirm the 9 nt exon). Strain="H99", variety="grubii".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTACGCTCTTCCCCAAATCCAGAAGCCTGCTCCGTGAGTATACATTTACGACTTTTTGGGATGTTGGATGTCATTCGGCCGGATCGGCCGACTGCGCCTCCGGCCCAGACGT
ACCCAATGGCATCCTGCGTTCCCATAGGTCTTCCATATGCTGGTTATCCCCCTGACTGCCCATCTATAGTAACTTTGCCGGTACCGCCGTCAAGGAGGGTTCTTTTGAGGAGATCAAGCT
TGATGACTTCAAGGGCAAGTG
GTAAGTCTACTTTCCATCCCCTTATCTATGGAGCATCTTGCTTATTCATCATGTTTTTCACAGGACTGTCCTCGTCTTCTATCCCATGGTAAGTTTGAT
TGCCACCCAGCCTAATTTGCAGTTTCTCACTTTGTTTTCATTGTTCTGGTTTGGTTTACCATATAGGACTTCACCTGTACGTATTGGCCTATCTTCGGCTTGCCCGCGCGACTCGCTGAC
TGTACTATTTTATAGTCGTTTGCCCTACTGAAATTCTTGCCTTCAACAAGGCCCTCGACCAGTTCGCCGCTATCGGTGCCGAGGTCATCTGTGTCTCCACCGACTCTGAATTCACCCACC
TTGCCTGGTCTCAGACCAAGAGGAGCGAGGGTGGTCTTGGCCCTGACCTCAAGTTGACTTTG
GTGAGTTTTTTCCTACCTTAAATGTCTTGGCATCCGTAATTGACCACAATTTACAGCT
CGCCGACCGAAACCATGCCGCTGCCAAGGCCTACGGTGTCCTTCTCCCTGAGGAGGGTGTCGCCCTCCGAGGCACCTTCTTCATTGACCCTAAGGGTACCCTCCGCGCCATGCACGTTCA
CGACCTTCCCGTCGGTCGCTCCGTCGAGGAGACCATCCGTGTCATCAAGGCCTTCCAGTTCACAGACGAGCACGGTGAAGTCTGCCCAGCCGGCTGGGAGGAGGGCAAGGACACCATCGA
CACCTCCGCGCCCTCTGCTTACTTTTCTAAGCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTACGCTCTTCCCCAAATCCAGAAGCCTGCTCCTAACTTTGCCGGTACCGCCGTCAAGGAGGGTTCTTTTGAGGAGATCAAGCTTGATGACTTCAAGGGCAAGTGGACTGTC
CTCGTCTTCTATCCCATG
GACTTCACCTTCGTTTGCCCTACTGAAATTCTTGCCTTCAACAAGGCCCTCGACCAGTTCGCCGCTATCGGTGCCGAGGTCATCTGTGTCTCCACCGACTCT
GAATTCACCCACCTTGCCTGGTCTCAGACCAAGAGGAGCGAGGGTGGTCTTGGCCCTGACCTCAAGTTGACTTTG
CTCGCCGACCGAAACCATGCCGCTGCCAAGGCCTACGGTGTCCTT
CTCCCTGAGGAGGGTGTCGCCCTCCGAGGCACCTTCTTCATTGACCCTAAGGGTACCCTCCGCGCCATGCACGTTCACGACCTTCCCGTCGGTCGCTCCGTCGAGGAGACCATCCGTGTC
ATCAAGGCCTTCCAGTTCACAGACGAGCACGGTGAAGTCTGCCCAGCCGGCTGGGAGGAGGGCAAGGACACCATCGACACCTCCGCGCCCTCTGCTTACTTTTCTAAGCAGTAA

Retrieve as FASTA