Entry information : CnPrxV_grubiiH99
Entry ID 11052
Creation 2012-05-21 (Catherine Mathe)
Last sequence changes 2012-05-21 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: CnPrxV_grubiiH99
Name CnPrxV_grubiiH99
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnPrxV_grubiiH99
start..stop
S start..stop
CnPrxV_JEC21 433 3e-157 1..224 1..224
AmusPrxV 153 2e-47 42..221 2..178
AthiPrxV 149 7e-46 42..224 2..178
SbrePrxV01 145 2e-44 65..224 25..178
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49880..49938 59 N° 2 49759..49823 65 N° 3 49501..49681 181 N° 4 49240..49418 179
N° 5 49006..49155 150 N° 6 48853..48893 41  
complement(join(48853..48893,49006..49155,49240..49418,49501..49681,49759..49823 ,49880..49938))


exon

Literature and cross-references CnPrxV_grubiiH99
DNA ref. JGI genome:   cneoH99_Chr14 (49938..48853)
Protein sequence: CnPrxV_grubiiH99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   23580.49  
PI (pH):   %s   9.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFRIATATARAIPARAAATRSIMTLRRVTIPQVSPKGYRSSILQDTAKTAHSAFANLASAAPIKKGDKMPDVEIKIDGPEGKVNLGKEKGKNVVVLVPGAFSGVCSNQVPPYITSFSDFKAKGINNVYVVAVNDIFVVNAWKDKMLGEFGSKEAEGVKAADDTAALASALGLTFDAQPVFGGPRLKRGVLVVNDGAVEYVGVEDSPGDITISAADKVIKQI

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Strain="H99", variety="grubii".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATTCAGAATCGCAACCGCCACAGCCAGGGCTATCCCAGCAAGGGCCGCAGCTACGTGAGTCGGCTGTGTAGCGAACCCGAGATTACCACGCTCATTTCTATTTGATTTAGACGAT
CAATTATGACCCTTAGGAGAGTCACCATCCCACAGGTCTCTCCCAAAGGCTACAGGCAGT
GTGCGTATTTATGACATATTGTGGGATGGGGAGAGAGTAGAGCTGGCTGACACTCGGATG
CTTGGATCGTTGACCAGCATCCATCCTCCAAGACACAGCCAAAACAGCGCACTCGGCCTTTGCCAACCTCGCTTCCGCCGCGCCTATCAAGAAGGGGGATAAGATGCCGGATGTAGAGAT
CAAGATTGATGGCCCTGAGGGGAAAGTGAATTTGGGCAAGGAAAAGGGGAAGAATGTGGTCGTTTTGGTTCCTGGAGC
GTAAGTCCATTCAGATTATTCGAGTGTTCGAATGTTTGAGTG
TTTAAAGGGAGCGGAGGCTGAGCTCTATGTGACGGTATAGATTCTCGGGCGTCTGCTCAAACCAAGTCCCTCCTTACATCACCTCTTTCTCCGATTTCAAAGCCAAAGGGATCAACAATG
TCTACGTCGTAGCAGTGAATGATATCTTTGTGGTGAATGCTTGGAAGGACAAGATGCTTGGAGAGTTTGGCTCGAAAGAGGCAGAAGGAGTCAAGTTTG
GTAAGTCAATCCCTCCGAATG
GGTTTGTTCCCTTGAGTGAGGAGGTACTGATATGATTTATTAACCTTTTTCCAATGTTATTAGCCGCCGACGACACTGCTGCCCTCGCCTCGGCCCTTGGCCTCACCTTCGACGCCCAAC
CCGTGTTTGGTGGACCCCGGCTTAAGCGCGGCGTATTGGTCGTTAATGATGGGGCGGTAGAGTATGTCGGTGTGGAGGATAGTCCTGGCGATA
GTACGTATCATCTCTTTCTTTTTCTTC
TTCGTGCCCTGTCCTTATTGACAAAGGGGTTAATTCGGATTGAGGATCGAAGGTTCGGAAGCTGATTTTGGACTGTACCTTGTAGTCACCATCTCTGCTGCTGATAAAGTCATTAAGCAA
ATTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATTCAGAATCGCAACCGCCACAGCCAGGGCTATCCCAGCAAGGGCCGCAGCTACACGATCAATTATGACCCTTAGGAGAGTCACCATCCCACAGGTCTCTCCCAAAGGCTACAGG
CAGT
CATCCATCCTCCAAGACACAGCCAAAACAGCGCACTCGGCCTTTGCCAACCTCGCTTCCGCCGCGCCTATCAAGAAGGGGGATAAGATGCCGGATGTAGAGATCAAGATTGATGGC
CCTGAGGGGAAAGTGAATTTGGGCAAGGAAAAGGGGAAGAATGTGGTCGTTTTGGTTCCTGGAGC
ATTCTCGGGCGTCTGCTCAAACCAAGTCCCTCCTTACATCACCTCTTTCTCCGAT
TTCAAAGCCAAAGGGATCAACAATGTCTACGTCGTAGCAGTGAATGATATCTTTGTGGTGAATGCTTGGAAGGACAAGATGCTTGGAGAGTTTGGCTCGAAAGAGGCAGAAGGAGTCAAG
TTTG
CCGCCGACGACACTGCTGCCCTCGCCTCGGCCCTTGGCCTCACCTTCGACGCCCAACCCGTGTTTGGTGGACCCCGGCTTAAGCGCGGCGTATTGGTCGTTAATGATGGGGCGGTA
GAGTATGTCGGTGTGGAGGATAGTCCTGGCGATA
TCACCATCTCTGCTGCTGATAAAGTCATTAAGCAAATTTAA

Retrieve as FASTA