Entry information : CnPrxQ_grubiiH99
Entry ID 11053
Creation 2012-05-21 (Catherine Mathe)
Last sequence changes 2012-05-21 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: CnPrxQ_grubiiH99
Name CnPrxQ_grubiiH99
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnPrxQ_grubiiH99
start..stop
S start..stop
CnPrxQ_JEC21 303 1e-107 1..167 1..167
LbiPrxQ02 165 2e-52 11..162 69..222
PcPrxQ02 163 9e-52 22..153 88..217
AthiPrxQ 160 3e-50 22..162 104..242
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 608569..608736 168 N° 2 608394..608513 120 N° 3 608278..608342 65 N° 4 608194..608220 27
N° 5 608057..608137 81 N° 6 607959..608001 43  
complement(join(607959..608001,608057..608137,608194..608220,608278..608342,6083 94..608513,608569..608736))


exon

Literature and cross-references CnPrxQ_grubiiH99
DNA ref. JGI genome:   cneoH99_Chr3 (608736..607959)
Protein sequence: CnPrxQ_grubiiH99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18709.46  
PI (pH):   %s   5.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPHEDNEEHEDEEDGEVLKKGDRLPSIKLKDEEGNTVDVSTLAGEKGVVFFLYPKADTPGCTNQACGYRDMFDEIAVFGYEVYGLSKDTPTAQQKWKAKKSLNYHLLSDPKSKLIKRLGAFVPPKNTKRSHFIFEKGTGNLIDIDIGVRPAEDPNNVLGFLTEKYL

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Strain="H99", variety="grubii".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCTCACGAAGATAACGAAGAGCATGAGGATGAAGAGGATGGCGAGGTGTTGAAGAAGGGAGATAGGCTTCCAAGCATCAAACTGAAGGATGAGGAAGGCAACACGGTTGATGTT
TCGACATTGGCCGGTGAAAAAGGCGTTGTGTTCTTCTTGTACCCCAAG
GTGGGCCCATTCTTGGATAACAATCAAAATGTATCATTTACTGACATAATTCAAGGCCGACACACCAGGGTG
TACTAACCAAGCATGCGGTTACAGAGACATGTTCGACGAAATTGCAGTATTTGGTTATGAGGTTTATGGACTCTCAAAAGATACTCCGACTGCACAACAAAAG
GTACCCAAGATTGCCGC
TGTTCTGTCGAGCCCAGGGCTGATATAATTTCAGTGGAAAGCCAAAAAATCCCTCAACTATCATCTTCTCAGTGATCCCAAGAGCAAGCTGATCAAAAGGTTAGTCACTGACTTCCATCC
AATGTCATCCTCGCTCATTTCTTGATACCTCATTAGGCTGGGTGCATTTGTTCCTCCCAAAAAGTCAGTGCTTCTAACAATGCAATGCCGCTCCTATGTGCTGACAGTCAAATATATAGC
ACCAAGCGTTCTCATTTCATTTTTGAGAAGGGAACAGGCAATCTCATTGACATTGATATTGGCGTCAGGCCTGCAGAAGA
GTAAGTTTGATACATCAGAAGGGTCAAGGAGAACTTGGCT
GACTTGATTTGATAGTCCCAACAATGTTCTCGGGTTCTTAACTGAGAAATATTTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCTCACGAAGATAACGAAGAGCATGAGGATGAAGAGGATGGCGAGGTGTTGAAGAAGGGAGATAGGCTTCCAAGCATCAAACTGAAGGATGAGGAAGGCAACACGGTTGATGTT
TCGACATTGGCCGGTGAAAAAGGCGTTGTGTTCTTCTTGTACCCCAAG
GCCGACACACCAGGGTGTACTAACCAAGCATGCGGTTACAGAGACATGTTCGACGAAATTGCAGTATTTGGT
TATGAGGTTTATGGACTCTCAAAAGATACTCCGACTGCACAACAAAAG
TGGAAAGCCAAAAAATCCCTCAACTATCATCTTCTCAGTGATCCCAAGAGCAAGCTGATCAAAAGGCTGGGT
GCATTTGTTCCTCCCAAAAA
CACCAAGCGTTCTCATTTCATTTTTGAGAAGGGAACAGGCAATCTCATTGACATTGATATTGGCGTCAGGCCTGCAGAAGATCCCAACAATGTTCTCGGG
TTCTTAACTGAGAAATATTTATAG

Retrieve as FASTA