Entry information : EglPrxQ01
Entry ID 11054
Creation 2012-05-21 (Qiang Li)
Last sequence changes 2012-05-21 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: EglPrxQ01
Name EglPrxQ01
Class Atypical 2-Cysteine peroxiredoxin (type Q)     [Orthogroup: PrxQ001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrxQ01
start..stop
S start..stop
EgrPrxQ01 539 0 1..268 29..296
EguPrxQ01 479 2e-173 10..268 38..296
EcamPrxQ01 477 9e-173 11..268 40..298
PtPrxQ01 345 5e-122 56..267 1..212
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..360 360 N° 2 460..597 138 N° 3 1016..1105 90 N° 4 1324..1539 216
join(1..360,460..597,1016..1105,1324..1539)


exon

Literature and cross-references EglPrxQ01
Protein sequence: EglPrxQ01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   268
PWM (Da):   %s   29267.41 Transmb domain:   %s   i29-51o
PI (pH):   %s   10.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
KNTGRRRRRNATLADPVASRGAQHSSKRIICLPFSLIFLGPFFFIPSSALILSSTMATLSLPKHSLPSLLPPQTPRTQSPRTPTFLPKSTQSQFHGLKLSNSSSPSVPSSFSAKSTVFAKVNKGQAPPAFTLKDQDGKTVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDVGDKVRKDWGVPSDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQSA

Retrieve as FASTA  
Remarks Partial sequence from genomic. First exon is missing. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAACACAGGAAGAAGAAGAAGAAGAAACGCAACGCTTGCTGATCCGGTCGCAAGCAGAGGCGCACAGCACAGCAGCAAAAGAATAATCTGTTTGCCCTTTTCTCTTATTTTTCTTGGG
CCTTTCTTTTTTATCCCTTCATCTGCTCTGATTCTGAGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCCGTCTCTGCTCCCACCTCAGACGCCCAGAACCCAATCTCCC
CGGACCCCAACGTTCTTGCCCAAGTCGACGCAGTCTCAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTTCTTCCTTCTCCGCCAAGAGCACCGTCTTTGCCAAG
GTACATTGTCCCACGTCCAGAGATTTGGAGGCATTTGGAGGGCTAAGCCAAGAGGGTTACTAATGTCTTCCCGTTTCTGTTTGTGGAAACTTCCTGCAGGTGAACAAAGGCCAAGCCCCG
CCAGCCTTCACGCTGAAGGATCAGGACGGCAAGACCGTGAGCCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACGCCAGGTTGCACCAAGCAG
GTA
ACTTGAACGACCTGCTCTTCCGGTGTTCTTTTTTGTTGGTTTGTGGGGGAGATTCAAGTGGTTGGTCCTGTTGGACAATGGCAATCCGTGATAAGGGGCATNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNTTCACAATCACTTGTCTTTCTCTCTCTTTTGCCGAATATGGTGGTGAAATGAGTATGCTCTGAGCTAGACTGCGCCCAATTGCTTTACTTTCTTTGAAAGAAT
TTGAGTACAATGTGTTGAGTTGCTCAGTGTAGCTAATAGCTATTGATAGATAGAGATGAATTCAGCGATTTCTCCNNNNNNNNNNNNNNNNNNNNNNNNCTAGACATTGCTGAATCGACC
GCAGGGAATTTTCCTTGTGAAGAATTGGGTTTACTAAGCATGCCGTTTCTGTCAGGCCTGCGCTTTCAGGGATTCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGTGGTTGGAATCAG
TGGGGACGACTCGTCTTCGCATAAG
GTATTGGACAAAGTTCATCTGTTTCCTGTAATTGATTATGTGTTTGCATCATTTGAGCTTTTGGAAAATTAATGCTGAAAGCTGTAGGAACAAGT
GATAGATTTGTCAGGAATGTTTAAGTCTTTCTGGGTACATGTTTAATGAAACTGCAATACTCGGATTTTGCACCAAAATGCTAATGTTTCGCTGCTGACAATGAGTTTCATTGTTAACGT
CAGGCATTCGCCAAGAAGTATAGACTTCCATTCACATTGCTCAGCGATGTCGGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGGCATTGCCTGGAAGACAGACT
TACGTACTCGACAAGAATGGTGTGGTTCAGCTCATTTACAACAACCAATTCCAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAACACAGGAAGAAGAAGAAGAAGAAACGCAACGCTTGCTGATCCGGTCGCAAGCAGAGGCGCACAGCACAGCAGCAAAAGAATAATCTGTTTGCCCTTTTCTCTTATTTTTCTTGGG
CCTTTCTTTTTTATCCCTTCATCTGCTCTGATTCTGAGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCCGTCTCTGCTCCCACCTCAGACGCCCAGAACCCAATCTCCC
CGGACCCCAACGTTCTTGCCCAAGTCGACGCAGTCTCAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTTCTTCCTTCTCCGCCAAGAGCACCGTCTTTGCCAAG
GTGAACAAAGGCCAAGCCCCGCCAGCCTTCACGCTGAAGGATCAGGACGGCAAGACCGTGAGCCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACG
CCAGGTTGCACCAAGCAG
GCCTGCGCTTTCAGGGATTCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGTGGTTGGAATCAGTGGGGACGACTCGTCTTCGCATAAGGCATTCGCCAAG
AAGTATAGACTTCCATTCACATTGCTCAGCGATGTCGGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGGCATTGCCTGGAAGACAGACTTACGTACTCGACAAG
AATGGTGTGGTTCAGCTCATTTACAACAACCAATTCCAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCC

Retrieve as FASTA