Entry information : CheCIIAB01_C5
Entry ID 11058
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2012-05-21 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-02-14 (Nizar Fawal)
Peroxidase information: CheCIIAB01_C5
Name CheCIIAB01_C5
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus heterostrophus    [TaxId: 5016 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CheCIIAB01_C5
start..stop
S start..stop
CheCIIAB01_C4 677 0 1..329 1..329
COsaCIIAB01 630 0 1..329 1..329
ClunCIIAB03 476 7e-171 1..327 1..331
AbraCIIAB01 426 5e-151 1..329 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1050986..1051574 589 N° 2 1051645..1052045 401  
join(1050986..1051574,1051645..1052045)


exon

Literature and cross-references CheCIIAB01_C5
DNA ref. JGI genome:   scaffold_14 (1050986..1052045)
Protein sequence: CheCIIAB01_C5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (310)
PWM (Da):   %s   35126.56 (33139.5)  
PI (pH):   %s   8.2 (7.98) Peptide Signal:   %s   cut: 20 range:20-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYIRNILVSGLVAASTVQAYNNDTFGEDEKWIVADPAPVQKRQLINVFGLISSFFGGGNQQDSSQCPAIWTQISATLTQQFSANGECTDAARAAIRAAFHDCFPGACDGSLILANECAQAPSRALQGFCSNLAGVASQTNVGVGDLIQFAAAHAIKTCPEGPTVPVRIGRQDSSRENDWRILPRGDARGNDIVRLFSSKGFSPVDLAALLGAHSTAKQQFFDPSQAGAALDSTPGVWDIKYYTETLRGNAPFTLPADRNVARNPATALAFARFGVDKKAWDDAFVVAMVKMGMMGVTNRNMIDCTSALPKTSASKREVKEKRVSGRFTW

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAACATTCTGGTCTCTGGCCTAGTGGCTGCCAGTACAGTGCAAGCCTACAACAATGACACATTTGGCGAAGATGAAAAGTGGATAGTAGCAGATCCAGCTCCAGTACAA
AAGCGACAACTCATCAACGTCTTCGGCCTCATCAGCAGCTTCTTCGGCGGCGGCAACCAACAAGATTCAAGCCAGTGCCCTGCCATCTGGACCCAAATATCTGCCACTCTTACCCAACAA
TTCTCCGCAAACGGCGAATGCACAGATGCCGCCCGGGCCGCCATCCGAGCTGCTTTCCACGACTGCTTCCCAGGAGCCTGTGACGGCTCTCTCATCCTAGCCAACGAATGCGCACAAGCC
CCAAGCCGCGCTCTCCAGGGCTTCTGCAGTAACCTGGCAGGCGTAGCCTCGCAAACCAACGTCGGCGTCGGCGATCTCATCCAATTCGCAGCCGCACACGCCATCAAGACATGTCCTGAA
GGTCCCACCGTTCCTGTGCGAATCGGACGACAAGACTCTAGCCGCGAAAACGACTGGAGAATACTACCACGAGGTGATGCCAGAGGAAACGATATCGTCAGGTTGTTCT
GTAAGTTTCCC
TCCAAACAGTTCTTTTTTTTTTTCCTAAAAAAACACTCTTCTAACAAAACATATAACAGCCTCAAAAGGCTTCTCCCCCGTCGACCTCGCCGCCCTCCTCGGCGCTCACTCAACCGCCAA
ACAGCAATTCTTCGATCCCTCCCAAGCCGGCGCCGCTCTCGACTCCACCCCAGGTGTCTGGGACATCAAGTACTACACAGAGACTCTGCGGGGAAACGCGCCTTTTACTCTCCCCGCTGA
TAGGAACGTTGCGAGGAATCCGGCGACGGCGCTGGCTTTTGCGCGGTTTGGGGTGGATAAGAAGGCGTGGGATGACGCGTTTGTTGTGGCTATGGTCAAGATGGGCATGATGGGTGTGAC
GAATCGGAATATGATTGATTGTACGAGTGCGTTGCCCAAGACAAGTGCTTCGAAGAGGGAGGTTAAGGAGAAGAGGGTTTCGGGGAGGTTTACGTGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAACATTCTGGTCTCTGGCCTAGTGGCTGCCAGTACAGTGCAAGCCTACAACAATGACACATTTGGCGAAGATGAAAAGTGGATAGTAGCAGATCCAGCTCCAGTACAA
AAGCGACAACTCATCAACGTCTTCGGCCTCATCAGCAGCTTCTTCGGCGGCGGCAACCAACAAGATTCAAGCCAGTGCCCTGCCATCTGGACCCAAATATCTGCCACTCTTACCCAACAA
TTCTCCGCAAACGGCGAATGCACAGATGCCGCCCGGGCCGCCATCCGAGCTGCTTTCCACGACTGCTTCCCAGGAGCCTGTGACGGCTCTCTCATCCTAGCCAACGAATGCGCACAAGCC
CCAAGCCGCGCTCTCCAGGGCTTCTGCAGTAACCTGGCAGGCGTAGCCTCGCAAACCAACGTCGGCGTCGGCGATCTCATCCAATTCGCAGCCGCACACGCCATCAAGACATGTCCTGAA
GGTCCCACCGTTCCTGTGCGAATCGGACGACAAGACTCTAGCCGCGAAAACGACTGGAGAATACTACCACGAGGTGATGCCAGAGGAAACGATATCGTCAGGTTGTTCT
CCTCAAAAGGC
TTCTCCCCCGTCGACCTCGCCGCCCTCCTCGGCGCTCACTCAACCGCCAAACAGCAATTCTTCGATCCCTCCCAAGCCGGCGCCGCTCTCGACTCCACCCCAGGTGTCTGGGACATCAAG
TACTACACAGAGACTCTGCGGGGAAACGCGCCTTTTACTCTCCCCGCTGATAGGAACGTTGCGAGGAATCCGGCGACGGCGCTGGCTTTTGCGCGGTTTGGGGTGGATAAGAAGGCGTGG
GATGACGCGTTTGTTGTGGCTATGGTCAAGATGGGCATGATGGGTGTGACGAATCGGAATATGATTGATTGTACGAGTGCGTTGCCCAAGACAAGTGCTTCGAAGAGGGAGGTTAAGGAG
AAGAGGGTTTCGGGGAGGTTTACGTGGTAA

Retrieve as FASTA