Entry information : CheKat03_C5
Entry ID 11068
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2012-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-22 (Christophe Dunand)
Peroxidase information: CheKat03_C5
Name CheKat03_C5
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus heterostrophus    [TaxId: 5016 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CheKat03_C5
start..stop
S start..stop
CheKat03_C4 1511 0 1..730 1..730
PnoKat03 1077 0 5..725 3..720
PEchKat03 975 0 5..729 2..729
AnKat02 937 0 9..729 5..725
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1976606..1976882 277 N° 2 1976316..1976552 237 N° 3 1976078..1976267 190 N° 4 1975980..1976015 36
N° 5 1975735..1975924 190 N° 6 1975516..1975680 165 N° 7 1974363..1975460 1098  
complement(join(1974363..1975460,1975516..1975680,1975735..1975924,1975980..1976 015,1976078..1976267,1976316..1976552,1976606..1976882))


exon

Literature and cross-references CheKat03_C5
DNA ref. JGI genome:   scaffold_1 (1976882..1974363)
Protein sequence: CheKat03_C5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   730 (711)
PWM (Da):   %s   79694.99 (77737.0)  
PI (pH):   %s   6.43 (6.22) Peptide Signal:   %s   cut: 20 range:20-730
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVRSNVLTAIAAICHVAHAVCPYMDDQPLARREGATAMSTDDFMKQYEIDDSKAYLTSPVGGPQPDQESLSAGERGPSLLEDQILRRKIMSFDHERVPERAVHARGAGAHGTFKSYGDWSNITGASFLANSEKETPVFIRFSTVAGSRGSADTARDVHGFAVRFYTDEGNFDIVGNNIPVFFIQDAIKFPDLIHAVKPKPDREIPQAATAHDSAWDFFSQQPSTMHTLLWAMSGHGTIRSYRHTDGWGVHTFRFVRDDGKSKLVKFRFRSLQGKASLLWEEAQTTAGMNADMHRQDLFESIENGYYPEWFEAQIMEESDQLRFGFDVLDPTKIVPEDIVPFTPLGKLTLNRNPRNYFAETEQIMFQPGHLVRGIDVSDDPLLQGRMFSYLDTQLNRNGGPNFEQIPINQPRVPVHNNERDGAGQMYIPLNTAAYSPNTLNGGYPKQATQAEGRGFFTAPSRSVSGNLVRTVSSTFADNWSQPRLFYNSLSAVEQQFVINAIRFETSQLQSEVVKQNVLIQLNRISHDIATRVATALGMTAPAPDDKFYHNNKTIGVNPAGEPLLKIEGLKVGYLTSAGSTGDKGKALKAALKDEKVSLTVVAEHLGAGIDQTYSATSAVNFDAIIVDGSASALFAPAGSLANSNSTAAKGRSTLYPAGRPLEILQTGYQFGKPVGVLGASNSTLSAAGVVAGTPGVYSFDSASDMAAVVTKITEGLRTFKFLDRYPLDN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTACGGTCTAACGTTTTGACAGCAATTGCTGCTATTTGCCATGTCGCTCACGCTGTTTGCCCCTACATGGATGACCAACCACTCGCCCGCCGCGAGGGTGCCACTGCCATGTCAACT
GATGATTTCATGAAGCAGTATGAGATTGACGACAGCAAGGCCTACCTCACGAGTCCTGTGGGAGGGCCCCAACCCGACCAAGAGAGCCTCTCGGCTGGTGAGCGAGGTCCATCACTGCTC
GAGGATCAAATTCTCCGCCGGAAAATCATGAGCTTTG
GTAAGAGTAATAGAAATCTCCGCATCTGACGGTTTAATAACCTAGCCGTTTAGATCACGAGCGTGTTCCTGAGCGCGCCGTGC
ACGCCCGTGGTGCCGGTGCTCATGGAACGTTCAAGTCATATGGTGACTGGTCTAATATTACCGGAGCCTCCTTCCTTGCCAACTCTGAGAAGGAAACCCCAGTTTTCATTCGATTCTCTA
CTGTTGCAGGAAGCCGTGGCTCCGCCGATACTGCCCGAGATGTTCATGGCTTTGCTGTCAGGTTCTACACCGACGAAGGCAACTTTG
GTAAGCCCCATAATGACGACACACAGATGCGGT
ATTAACAGTCTCTAGATATTGTCGGTAACAACATTCCTGTTTTCTTTATCCAGGATGCCATCAAGTTCCCTGATCTCATCCACGCTGTCAAGCCCAAGCCGGACCGTGAGATTCCTCAGG
CAGCAACGGCTCACGATTCGGCATGGGACTTCTTCAGTCAGCAGCCTAGCACCATGCACACCCTCCTGTGGGCTATGAGTGGACA
GTGAGTGAATATGTAAAATGTTTGAGCAGGACGAT
TACTAACAAGTTTTTTCTTTCTTGCAGTGGTACCATTCGTTCCTACAGGCATACCGATGGCTGGTAAGAACAACCTTTCTCATGTTTAGATGAACAATGTACTAACTCATCTGTCTAGGG
GTGTACACACTTTCCGCTTTGTCCGTGACGACGGCAAGTCCAAGCTCGTCAAGTTCCGCTTCCGATCTCTCCAGGGTAAGGCCTCCCTGTTGTGGGAAGAGGCTCAAACCACTGCCGGAA
TGAACGCGGATATGCACCGACAGGATCTCTTCGAGAGCATCGAGAACGGCTACTACCCAGAATGGATC
GTACGTACCCCTAGTCTATCCAAAGACGATGATTGCTAACCTTTTGGTGTTT
AGTTTGAGGCCCAAATCATGGAGGAGTCGGACCAACTTCGATTCGGATTCGACGTTCTCGACCCCACCAAGATTGTTCCCGAAGACATTGTTCCTTTCACCCCTCTTGGAAAGTTGACCT
TGAACCGCAACCCTCGCAACTACTTTGCCGAGACTGAGCAAATTATG
GTATGTTCCGGTGCCACCTTGATGGGGTGTCTGAATGCTTACTTTGTGTCTCTAGTTCCAACCTGGTCATCTC
GTCCGCGGTATTGATGTTTCCGACGACCCGCTCCTTCAAGGACGCATGTTCTCGTACTTGGACACTCAGTTGAACCGCAACGGTGGTCCCAACTTTGAACAGATCCCTATCAACCAGCCC
CGTGTTCCCGTCCACAACAACGAGCGTGATGGTGCCGGCCAAATGTATATTCCTCTCAACACTGCCGCCTACTCGCCCAACACCTTGAACGGTGGTTACCCCAAGCAAGCCACCCAGGCC
GAAGGTCGCGGGTTCTTCACAGCACCCTCTCGATCCGTCAGCGGAAACCTTGTCCGCACCGTCTCCAGCACCTTTGCCGACAACTGGTCGCAGCCTCGTCTGTTCTACAATTCCTTGTCC
GCAGTCGAGCAGCAGTTTGTCATCAATGCCATCCGATTTGAGACTTCGCAACTCCAGAGCGAGGTTGTCAAGCAGAACGTCTTGATCCAGCTTAACCGTATCAGCCACGACATTGCTACC
CGTGTTGCTACTGCTCTTGGCATGACTGCACCCGCACCTGATGACAAGTTCTACCACAATAACAAGACGATTGGTGTTAACCCGGCTGGCGAGCCCCTGCTCAAGATCGAGGGCTTGAAG
GTTGGATACCTTACCTCTGCGGGATCCACTGGCGACAAGGGCAAGGCGCTCAAGGCCGCGCTCAAGGACGAGAAGGTTAGCTTGACGGTAGTCGCTGAGCACCTTGGCGCTGGCATTGAC
CAGACCTACTCTGCTACTTCGGCCGTTAACTTTGACGCCATCATCGTTGATGGTAGCGCTTCAGCCCTCTTCGCCCCCGCGGGCAGCCTCGCCAACTCCAACTCCACGGCTGCCAAGGGC
CGTTCCACTTTGTACCCTGCTGGTCGCCCTCTCGAGATCCTCCAGACCGGTTACCAGTTTGGCAAGCCCGTTGGTGTTCTCGGAGCCAGCAACTCGACTCTATCTGCTGCTGGTGTTGTG
GCCGGCACCCCTGGTGTTTACAGCTTCGACTCCGCCAGCGACATGGCGGCAGTTGTTACCAAGATCACTGAGGGTCTGCGCACTTTCAAGTTCCTTGACAGGTACCCATTGGACAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTACGGTCTAACGTTTTGACAGCAATTGCTGCTATTTGCCATGTCGCTCACGCTGTTTGCCCCTACATGGATGACCAACCACTCGCCCGCCGCGAGGGTGCCACTGCCATGTCAACT
GATGATTTCATGAAGCAGTATGAGATTGACGACAGCAAGGCCTACCTCACGAGTCCTGTGGGAGGGCCCCAACCCGACCAAGAGAGCCTCTCGGCTGGTGAGCGAGGTCCATCACTGCTC
GAGGATCAAATTCTCCGCCGGAAAATCATGAGCTTTG
ATCACGAGCGTGTTCCTGAGCGCGCCGTGCACGCCCGTGGTGCCGGTGCTCATGGAACGTTCAAGTCATATGGTGACTGGTCT
AATATTACCGGAGCCTCCTTCCTTGCCAACTCTGAGAAGGAAACCCCAGTTTTCATTCGATTCTCTACTGTTGCAGGAAGCCGTGGCTCCGCCGATACTGCCCGAGATGTTCATGGCTTT
GCTGTCAGGTTCTACACCGACGAAGGCAACTTTG
ATATTGTCGGTAACAACATTCCTGTTTTCTTTATCCAGGATGCCATCAAGTTCCCTGATCTCATCCACGCTGTCAAGCCCAAGCCG
GACCGTGAGATTCCTCAGGCAGCAACGGCTCACGATTCGGCATGGGACTTCTTCAGTCAGCAGCCTAGCACCATGCACACCCTCCTGTGGGCTATGAGTGGACA
TGGTACCATTCGTTCC
TACAGGCATACCGATGGCTG
GGGTGTACACACTTTCCGCTTTGTCCGTGACGACGGCAAGTCCAAGCTCGTCAAGTTCCGCTTCCGATCTCTCCAGGGTAAGGCCTCCCTGTTGTGGGAA
GAGGCTCAAACCACTGCCGGAATGAACGCGGATATGCACCGACAGGATCTCTTCGAGAGCATCGAGAACGGCTACTACCCAGAATGGATC
TTTGAGGCCCAAATCATGGAGGAGTCGGAC
CAACTTCGATTCGGATTCGACGTTCTCGACCCCACCAAGATTGTTCCCGAAGACATTGTTCCTTTCACCCCTCTTGGAAAGTTGACCTTGAACCGCAACCCTCGCAACTACTTTGCCGAG
ACTGAGCAAATTATG
TTCCAACCTGGTCATCTCGTCCGCGGTATTGATGTTTCCGACGACCCGCTCCTTCAAGGACGCATGTTCTCGTACTTGGACACTCAGTTGAACCGCAACGGTGGT
CCCAACTTTGAACAGATCCCTATCAACCAGCCCCGTGTTCCCGTCCACAACAACGAGCGTGATGGTGCCGGCCAAATGTATATTCCTCTCAACACTGCCGCCTACTCGCCCAACACCTTG
AACGGTGGTTACCCCAAGCAAGCCACCCAGGCCGAAGGTCGCGGGTTCTTCACAGCACCCTCTCGATCCGTCAGCGGAAACCTTGTCCGCACCGTCTCCAGCACCTTTGCCGACAACTGG
TCGCAGCCTCGTCTGTTCTACAATTCCTTGTCCGCAGTCGAGCAGCAGTTTGTCATCAATGCCATCCGATTTGAGACTTCGCAACTCCAGAGCGAGGTTGTCAAGCAGAACGTCTTGATC
CAGCTTAACCGTATCAGCCACGACATTGCTACCCGTGTTGCTACTGCTCTTGGCATGACTGCACCCGCACCTGATGACAAGTTCTACCACAATAACAAGACGATTGGTGTTAACCCGGCT
GGCGAGCCCCTGCTCAAGATCGAGGGCTTGAAGGTTGGATACCTTACCTCTGCGGGATCCACTGGCGACAAGGGCAAGGCGCTCAAGGCCGCGCTCAAGGACGAGAAGGTTAGCTTGACG
GTAGTCGCTGAGCACCTTGGCGCTGGCATTGACCAGACCTACTCTGCTACTTCGGCCGTTAACTTTGACGCCATCATCGTTGATGGTAGCGCTTCAGCCCTCTTCGCCCCCGCGGGCAGC
CTCGCCAACTCCAACTCCACGGCTGCCAAGGGCCGTTCCACTTTGTACCCTGCTGGTCGCCCTCTCGAGATCCTCCAGACCGGTTACCAGTTTGGCAAGCCCGTTGGTGTTCTCGGAGCC
AGCAACTCGACTCTATCTGCTGCTGGTGTTGTGGCCGGCACCCCTGGTGTTTACAGCTTCGACTCCGCCAGCGACATGGCGGCAGTTGTTACCAAGATCACTGAGGGTCTGCGCACTTTC
AAGTTCCTTGACAGGTACCCATTGGACAACTAG

Retrieve as FASTA