Entry information : EglGPx08
Entry ID 11074
Creation 2012-05-22 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-28 (Christophe Dunand)
Peroxidase information: EglGPx08
Name EglGPx08
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglGPx08
start..stop
S start..stop
EcamGPx08 347 8e-125 1..170 1..169
EgrGPx08 342 4e-123 1..170 1..170
EguGPx08 326 1e-116 1..170 1..170
EguGPx09 261 4e-91 1..170 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..54 54 N° 2 178..252 75 N° 3 370..430 61 N° 4 1355..1473 119
N° 5 3905..4075 171 N° 6 4192..4224 33  
join(1..54,178..252,370..430,1355..1473,3905..4075,4192..4224)


exon

Literature and cross-references EglGPx08
Protein sequence: EglGPx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19197.86  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAQSADEKSLHQFVVKDSKGNEVNLSAYEGKVLLVVNVASKGFTEQNYTQLAELHNRYKDKGFEILAFPCNQFLRQEPDTSQEVEDFACNRYKVEFPIFQVCVNGQETAPLYKYLKARKTGFLGSRIKWNFTKFLVDKEGRVISRYGTITPPLAIEVEDIQKALGMA*

Retrieve as FASTA  
Remarks Complete sequence from NGS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCCGCCCAATCCGCGGACGAGAAATCCCTCCACCAGTTCGTCGTCAAGGTGGGCGTGTCGCTGCGCGAATCGTTCGCGAATCTCTCTTTCACGGGCTCGAAATTTACGTGGAAT
CGCGATGTTTTGATGTTAATGCTGATGCTGATGATGATGATGATGATGATGATGCAGGACAGCAAGGGCAATGAGGTGAATCTCAGTGCTTACGAAGGGAAGGTTCTTCTCGTCGTGAAC
GTTGCTTCCAAA
TGGTCTCTCTCACCCACCTCTCTCTTCTCATCAATTTTCTTCCTTTTTTTTTTTAGTGATGCGTTCGCTCTCAAACTAACAAGATTGATCTGTGGGTGTTTTTGGGTT
TGAAACAGTGGGTTCACCGAACAGAACTACACGCAGCTCGCTGAACTTCACAATAGGTACAAGGATAAAGGTCGGTTCTTTCGCCATTTTCTGTTCGGTTGCATTTTGTTGCATTCATGG
ATGTCGTCTTTTGTTATAATGGGTATGTTTCCGTGGTGATTATCATGGGAATTCCTACATTTTTCGACCGTGCAATGGAAGTAAGTATGGTGATGGGTGACTAGCACTATCAGTTGAGCT
TGTAAGTGGGGAAAGAAAACCATAGAAAGAAATACTGTATGTTTATGCCCCAAAAAATAGGAAAAATGCAAAATCAACCAGTGTTGGGGTACTCAAACATCTTCATGAGAAGCTAAATAG
CCTGGTGCTGTAAATGTTGGCCAAGTGATGCATAAATTGTCTTTATACTGCTTTTGTCCGAGGTATACTGTCCGATAAGATCATGAGGATGAATCGAGTCGAACCGAATTTTGTCTTCTA
CATTTATTAACCTACTGCTTTTTCCAATTTCTTTTTGTAACTGCTCCAATGCTTGATGATGCANNACTCTGCCTTGGCATCTTTGCTGGGGTTGCGGTCACTTCTAGGGGGTTGGCCATG
CATGCAAGTAAGAATCAGATAACTTGGGATGATCGAGTCAACCCAATTAATTGCAGATGCCAATTTTGAGCTTCATTTCCTTCTGGAAATCCCTATTCATTGTCAATCTGCAGAGCACTT
GTTCTTCATCTAATGTTGCAATAATCTCTTTGCTTTGTTCATCGTCTGTTTGGAAATTTGTGAACATTCGTAATAATTTGTCCCTCATGCTGTGCATTGCCATGGAAAGTTCTTTCCACT
GGAAATTTTTAAATAGAGAGTAGTCATTTTCTATATTGATTATTCCNNNNNNNNNNTTTAACATGCACTGCCGACCTTTCCTTCTTAGCCCCTCCCAAGATGAGTTTAATGAGTTTGAAA
TTGAAGGGAATGGCTGCTCCTGGGTTTTTCTCAGGATTCGAAATCTTGGCATTTCCATGCAACCAATTTCTCAGACAAGAGCCAGACACTAGCCAGGAGGTGGAAGATTTTGCTTGTAAC
AGATACAAAGTCGAATTTCCAATTTTCCAGAAG
GTATGCTTTTTAGCTGCTCTCTCGCAACTGTTTAGCTTTTCAGATTGATCATTTGAATTGTTATTTTATCAACTAGGTCCATTTCTT
TGTATGTTCCCCTCCTCTTGTATGTTTCTGCCAGGCAGTTATATAGATTTCCAAGATCTCTTCTTTCTTTTCGGCTCTAATTGGTTGCCGTGGCCTATGACTGAACTGATGCTTTTGTCT
CTCAATAATTACTTCTTTTTGTTGCTTCTCCGCAGGGTGCAAACTCTACGAAATCATGACTTATCTATTGTGGTCTTTGATGTTTATCAATGGTTAATAAGTGGGTCGAAATGTTTGTAG
TCATAGGACTTGTGGCCATTTTAGTTGGAATTCTGGATACCATTGTGCCCTGCTCATTTCTTTATCCCATTTGGGTTTTTTTTGGTTGTATAACATCATCAAGACTCGTGGGAATATGTT
TCATTAAAACAACCCCCCCACCCCCCAAATAAGAAATTAGAAAATGGTCGCTCCAAACCTGTGAAGCATACCTGTTACCTGCTTTGAAGTTCACACGGTTTGGTAGCCTTTTAATACTTG
CTGGATAGTTCTCTCCTCTGAGTTCCCTGAATTATATAAATATGAGTTATGCAGTAGCATTATTAATTTGTCTGGAAGTGTACATGCTTTGATCTCGTTCTTTTGTCACATCGTATCAAG
ACTGGTTAAAATGTTGAACAAGCTTTATCTAATAGGTCTGGCCATTCTTCAAGTTGATTCAACCGTCATTTTAGTAGTCAAGAGTTTTGTCATTTCATTTTGCAATCAGCTGTGAAAAAT
GTTTCAAGAAGTAATTACAGAAGGATTCTTTTTCTTGGACTCTTTAAGGAAAATCTCTCCGTAGAAGGTTAAGAGGTTTTATACCTTGACTGGAGGTTTGGATCACGAGGTACGTAGAAA
ATCAAATTGTTAAGAGTTCTTAAACCTTTACTGGAGGTTATGATAATGAGAATCATAGAAGATTCGATTGTTCTATACCTTCGAATTTCTTTTTACTTACTGAAAATCATCAAGTGTACT
GGGACATTGCACATATGCTTGTTATTCTTGTCTTTCATCAGTACTGTCTCTACACTGGGCAAATTATGTGGAGGGAGGAAATAAGGATCAAACCCAAGACATAATTCTTGATATGAGTTG
GTCACCGCTGGCTGGAAAATTTGTTCTGCATCTTGTACCTGTAATTTTTAGCCAGAATTAACATTGAAATGGCAGAAAGAAAAGGTGAAAGACAAACTGCCAGAGAGGATAAGGAACAAT
TAGATTAACCAAAATATAGAAGGCTTCTGGCTATAAAGTATTGAGGAGAAGTTGCAATACTGGTGTCCTTTCTGTAACACATCCAAAACCGTCTGGCTTCACAACTAAATTTAGAGGATT
ACCCAAATGCATTACCCAAACTTGAAGTAAACATATCCAAAATTGAGTAAACACATTATTAACACATTCTTCTTTGAAAAGATCCGTTGTGTAAGCCCCACGGCTTGTACATTGATTTAC
ACAACTTATCTTCATTTGTTTCCATATCCACATTTTATTCCATCTGGTGGTATGGCCAAGTCAACTGAGGATTCAGATGACATTTTAGAAAGTCTCTAGGAGAAATACTGTGAATTTTTT
TGCTTGGACTGCAAGTTTTCAATGATTACAATTTTCCTTGTTGGTGAAGTTATTTACAAAGAAGCCTGTAACCTGATTTCCATCAGGATAGTCCATCTGTTTTCTTTGTTTATTCAGCAA
TTATTTTTTAGTTGAGAATACTACCCAAACACATCATCAGTCTTCTGTCACTACCAGTAAAACTCAGGCGATCTTTTGGAAAATTATTAGAGAAGAATAATTCGAAAACATTTCATAGGT
TTGCAATTCTCAGATTCTTTTCAGGGTATGTTCTGTAGAAGAAGATCATAACTTGATCTCTCAGATAAATTCAGCCAGTACTTGACTTCTCACATGAAGAGCGTGGTTTGTTAGTATGTT
TGGCAATGTAGTTGTAATGAGGAAAATGCTTCACACGTTTGGCTTCTCATATTATTAAAGGCTGTACAACTCCCGGTGGTCTAAGATTCACAATCTGCCTCTTAAGGATTGTGGCCGCTG
GGCCTACCCTTATCTTGGGACAAGTCACATCTGATTGCATTATGAGTGTTTGTCGGGAGATTTTTCTAGTTGTTGATAGAAAACTCAAAATTACCTATTTTTAAGAACTATATCGACACA
TATTTACTACTTTATGATTTCTTGGACACTTTTCCTTGTACTCCACATTGCACAGCTCATGATAGATGTAATAGCTCTGTGGGTTTATATACCATAAATATTGGTTATCTCATACAATTT
GTTTGCTCATTTCGTATGACCAGTCGATTTATTTGAAGTTTTCAGTAGGTGCCTGTGGTTGTAGGTTTGCGTCAATGGGCAAGAAACAGCGCCCCTCTACAAATACCTCAAAGCACGTAA
AACTGGATTTTTGGGTTCAAGAATAAAATGGAACTTCACCAAGTTTTTAGTAGACAAGGAAGGGCGAGTCATCAGCCGCTACGGAACAATCACACCTCCACTAGCCATCGAGGTA
GCCGA
CAGTCTGTTCTGGCCCTCAAGTGCTCACTTCTCTGAACCACCCATTTCACTTAGCTTTGCAAGATACTTTTCCTAGTTGTTCGTTGACATTCATGGATATTTTCTATGCAGGAAGACATC
CAGAAAGCATTGGGAATGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCCGCCCAATCCGCGGACGAGAAATCCCTCCACCAGTTCGTCGTCAAGGACAGCAAGGGCAATGAGGTGAATCTCAGTGCTTACGAAGGGAAGGTTCTTCTCGTCGTGAACGTT
GCTTCCAAA
GGGTTCACCGAACAGAACTACACGCAGCTCGCTGAACTTCACAATAGGTACAAGGATAAAGGATTCGAAATCTTGGCATTTCCATGCAACCAATTTCTCAGACAAGAGCCA
GACACTAGCCAGGAGGTGGAAGATTTTGCTTGTAACAGATACAAAGTCGAATTTCCAATTTTCCAGAAG
GTTTGCGTCAATGGGCAAGAAACAGCGCCCCTCTACAAATACCTCAAAGCA
CGTAAAACTGGATTTTTGGGTTCAAGAATAAAATGGAACTTCACCAAGTTTTTAGTAGACAAGGAAGGGCGAGTCATCAGCCGCTACGGAACAATCACACCTCCACTAGCCATCGAGGTA
GAAGACATCCAGAAAGCATTGGGAATGGCATGA

Retrieve as FASTA