Entry information : EglGPx04
Entry ID 11077
Creation 2012-05-22 (Qiang Li)
Last sequence changes 2012-05-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-02-28 (Christophe Dunand)
Peroxidase information: EglGPx04
Name EglGPx04
Class Plant glutathione peroxidase     [Orthogroup: Gpx2003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglGPx04
start..stop
S start..stop
EgrGPx04 296 6e-105 1..144 17..160
EguGPx04 289 4e-102 1..144 17..160
StGPx08 253 1e-87 1..144 17..160
LeGPx08 251 3e-87 1..144 17..160
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..83 83 N° 2 374..435 62 N° 3 1273..1391 119 N° 4 1654..1887 234
join(1..83,374..435,1273..1391,1654..1887)


exon

Literature and cross-references EglGPx04
Protein sequence: EglGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   165
PWM (Da):   %s   19057.61  
PI (pH):   %s   5.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQDEKGNDVSLGEYRGKVLLIVNVASKCGLTNSNYTELNQLYERYKDGLEILAFPCNQFGNEEPGTNNEIKEFVCTRFKSEFPIFDSGTLPSSW*IRMG*L*IVITQRHLLLPLRYTCLQIMFFSN*CLGIMWSIX

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa. (PS)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGATGAGAAGGGAAATGATGTAAGTCTGGGTGAATATAGAGGGAAGGTCTTGCTTATTGTGAATGTGGCCTCGAAATGGTATGTACCTTATCCACCTTGTCTTTGTTCTGTCTCT
TGTTACCAAAATTATACTGAGGAAAACAAATATGATAGTGGATCTGAGGAAGAGAGATTTTGTAGAAATACGAAGAGAAGGGAGCGCATGGTGATTTTTGTTAGCGTGAACCTTTGAATT
CGGAGATATTGTTATGGAGATGTGATGCATTTAATAGCTTAGTTTCGTTTTACACTTCAAAAGCTCACCAAATGGATATTCTCTAGATTTTCCCTGTAAATATATTTACTCAATTGTCGT
TTGGTTTTGGCAGTGGATTGACTAACTCAAACTATACCGAGCTAAACCAGTTGTATGAGAGGTACAAAGATAAAGGTGAGCTCTTCAAACTCCATGTTTGAGTTCCCATCTTCCTTAGGT
GACTAATCCACCAGGGCTGCAGAAGTTGGAATTTTAAAGTAATGGTTTGTCAATTCTAATCCTTGGTATAAAACTATACTCTGGAGTATGGTGCTGAGGATGGAAAAGAGCTGGGGTACT
ACTTCACCGGTTGAGTGGATCTGAGTTTTTGTCATCAACCTTCGTGGACAAACCTCTCATTCTTTCCATCTTCCATTCTTTGGTTTTAAAACTGGTCGAAAACTTTCACAATGATCTCTT
AACTTATGGTGCTCACTCTAGCTGTTATCATCTTAGGGATGATCTTATTGTAAGCATAGTCTTTATCAGCCACTCTCCAACACCTTTTCACATCACTACCAGTGTTATATTTTTTGTATG
GCCTACACTTCTGATGCTCTGAAGATGAATGTTCTCCATCAACTTCTTTAGATGAAGTATTCTCTTACTTTGTAGAGCTGGCTCTGGTAAAAAAATTCTAACCCGCTGATCTTGGAATGT
GACATTTACTGCTAATATTTATGTCAGCAAGGGGAAAAAGGAATAGAAAGATCAATACTCATATGTTTGGTCCTTCATTCTCACTTCATTGACCTAATATATATTTCTATTCTCCAATTT
GCAATACTCCGTTTGCAAATTATGAGAATTTTTCTTGTGTTAGCTCTATTTCCTTTCCAGTTTTACTATGCACATTTGATTTGTGACAGTACTAGATGTTTGGTGGCATAGAAATTGATT
ATCCTGAACCAGAATTGTGAGAAGGTAATGCTTGAGTGACATTGGGTTTTCCTGATAAGTGAATTGGTGCAGGCTTGGAGATACTGGCCTTCCCATGCAATCAGTTTGGTAATGAGGAAC
CAGGAACAAACAATGAGATCAAGGAATTTGTTTGCACCCGCTTTAAGTCAGAATTTCCCATCTTCGATAAG
GTCTACAGGCAATGTTTTTGGTCTCCTACTTTCTGAAAACCTTGTTTAG
ACACAAATTTAAGTTATAATGGCTTGACCGCCCCTAAGATGTAAATGCCTCATTATATTCAAGATGCTGCTTCTTTTCCAAATTCTGTATTTGTGGTCTGAGGTCTGGTTCAGCAACAAG
GAATGAACATGATCGAAGTGAATGGGGACAAAGAAGCACCACTATATAAGTTCCTGAAATCAGGGAAATGGGGAATGTTCAAGGATGATATTCAGTGGAACTTTGCCAAGTTCCTGGTAG
ATCAGAATGGGGTGATTATAAATCGTTATTACCCAACGACATCTCCTCTTACCATTGAGGTATACCTGCTTACAGATCATGTTTTTCTCCAATTGATGCTTAGGGATCATGTGGTCTATA
TTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGATGAGAAGGGAAATGATGTAAGTCTGGGTGAATATAGAGGGAAGGTCTTGCTTATTGTGAATGTGGCCTCGAAATGTGGATTGACTAACTCAAACTATACCGAGCTAAACCAG
TTGTATGAGAGGTACAAAGATAAAG
GCTTGGAGATACTGGCCTTCCCATGCAATCAGTTTGGTAATGAGGAACCAGGAACAAACAATGAGATCAAGGAATTTGTTTGCACCCGCTTTAAG
TCAGAATTTCCCATCTTCGATAAG
AGTGGAACTTTGCCAAGTTCCTGGTAGATCAGAATGGGGTGATTATAAATCGTTATTACCCAACGACATCTCCTCTTACCATTGAGGTATACCTGC
TTACAGATCATGTTTTTCTCCAATTGATGCTTAGGGATCATGTGGTCTATATTTGA

Retrieve as FASTA