Entry information : NgrPrxII
Entry ID 11088
Creation 2012-05-29 (Christophe Dunand)
Last sequence changes 2012-05-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-29 (Christophe Dunand)
Peroxidase information: NgrPrxII
Name NgrPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Heterolobosea Vahlkampfiidae Naegleria
Organism Naegleria gruberi    [TaxId: 5762 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NgrPrxII
start..stop
S start..stop
PpaPrxII06 146 5e-45 8..184 13..198
CrePrxII0503 137 3e-42 29..181 3..158
MpPrxII01 137 5e-42 53..184 32..163
CrePrxII0501 137 9e-42 8..184 5..193
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 264946..265137 192 N° 2 264428..264790 363  
complement(join(264428..264790,264946..265137))


exon

Literature and cross-references NgrPrxII
DNA ref. GenBank:   GG738852.1 (265137..264428)
Protein sequence: NgrPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   184
PWM (Da):   %s   20039.65  
PI (pH):   %s   9.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRKTIPLFKKQSLIGSTVVSFRSAHTNVEVKPSTPVKLFKVTNEAVTTDDLFTSGKVIVFGVPGAFTPVCSNKHVPSYLNNSKALKEKGISKIICLSVNDSFVMKAWKEKVASGNEEIEFIADPLGEFTRQVGLEVDLTAAGLGKRSKRFSMLIENGKVKELFVEDSPGQLEKTTAENMLTLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCGTAAGACCATTCCTCTCTTCAAAAAACAATCATTGATTGGATCAACTGTTGTTTCATTCAGATCTGCCCACACCAATGTTGAAGTCAAGCCATCCACTCCAGTTAAACTCTTC
AAGGTTACCAATGAAGCTGTTACTACTGATGATTTGTTCACTTCTGGAAAGGTTATTGTCTTTGGTGTCCCA
GTAAGTATCATTTCGTTAGAATTTACTAATGTATTCTTCTTGTTTGAT
AACAATTTTATAATAATTTTAATATTTTTGGAATTAATTGATCGGAATGATCGGAATTAATTATATATCCATTATTATTACATCACACAACAATTATATAATAATAGGGTGCTTTCACTC
CAGTCTGTTCAAACAAGCACGTTCCAAGTTACCTTAACAATTCTAAAGCATTGAAGGAAAAGGGTATTTCCAAGATTATCTGCCTCAGTGTCAATGATAGTTTTGTCATGAAGGCCTGGA
AGGAAAAGGTTGCTTCTGGTAATGAAGAAATTGAATTCATTGCTGATCCATTGGGTGAATTCACTAGACAAGTTGGTCTTGAAGTCGATTTGACTGCCGCTGGTTTGGGAAAGAGATCTA
AGCGTTTCAGTATGCTTATTGAAAATGGTAAAGTTAAGGAATTGTTCGTTGAAGATTCTCCAGGTCAATTGGAAAAGACAACTGCTGAAAATATGCTCACTCTCCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCGTAAGACCATTCCTCTCTTCAAAAAACAATCATTGATTGGATCAACTGTTGTTTCATTCAGATCTGCCCACACCAATGTTGAAGTCAAGCCATCCACTCCAGTTAAACTCTTC
AAGGTTACCAATGAAGCTGTTACTACTGATGATTTGTTCACTTCTGGAAAGGTTATTGTCTTTGGTGTCCCA
GGTGCTTTCACTCCAGTCTGTTCAAACAAGCACGTTCCAAGTTACCTT
AACAATTCTAAAGCATTGAAGGAAAAGGGTATTTCCAAGATTATCTGCCTCAGTGTCAATGATAGTTTTGTCATGAAGGCCTGGAAGGAAAAGGTTGCTTCTGGTAATGAAGAAATTGAA
TTCATTGCTGATCCATTGGGTGAATTCACTAGACAAGTTGGTCTTGAAGTCGATTTGACTGCCGCTGGTTTGGGAAAGAGATCTAAGCGTTTCAGTATGCTTATTGAAAATGGTAAAGTT
AAGGAATTGTTCGTTGAAGATTCTCCAGGTCAATTGGAAAAGACAACTGCTGAAAATATGCTCACTCTCCTCTAA

Retrieve as FASTA