Entry information : NgrGPx02
Entry ID 11094
Creation 2012-05-30 (Christophe Dunand)
Last sequence changes 2012-05-30 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-20 (Qiang Li)
Peroxidase information: NgrGPx02
Name NgrGPx02
Class Other glutathione peroxidase    [Orthogroup: Gpx4001]
Taxonomy Eukaryota Heterolobosea Vahlkampfiidae Naegleria
Organism Naegleria gruberi    [TaxId: 5762 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NgrGPx02
start..stop
S start..stop
NgrGPx07 290 9e-103 3..163 2..162
NgrGPx03 245 8e-85 3..163 2..162
NgrGPx06 241 2e-83 3..163 2..162
ZaGPx04 210 4e-70 2..161 82..242
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 556078..556213 136 N° 2 556263..556345 83 N° 3 556432..556704 273  
join(556078..556213,556263..556345,556432..556704)


exon

Literature and cross-references NgrGPx02
DNA ref. GenBank:   GG738853.1 (556078..556704)
Protein sequence: NgrGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   18477.26  
PI (pH):   %s   6.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTDSDFYSFTVKDADLNDVSMADYKGKVVMIVNVASRCGFTKQYDEIQEVYNKYKDQGFEVLAFPCNQFGSEPGTNEEICTFARTKFKVTFKIFDKINVNGSETIPLYNFLKKEGAGFLVDAVKWNFTKFLVSKSGKVLKRYAPNTSPKDMEDDIQKLLKE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAACTGACTCTGATTTTTATTCATTTACTGTCAAGGATGCTGATTTAAATGATGTATCTATGGCTGATTATAAAGGAAAAGTAGTAATGATTGTGAATGTTGCCTCTAGATGTGGT
TTCACCAAACAGTACG
GTAGGTATTTGTTATTGGAAAGTGTTGGAAATGCTAACCGAATCAATAGACGAAATTCAAGAAGTTTATAACAAGTATAAGGATCAAGGTTTTGAAGTATTGGC
ATTCCCATGCAATCAATTCGGATCTCAA
GTAAGTTTCCTCTAAATTTTCAATCATCCAATTTAAACCAAACTATTCCTCATCATTAAAAATTAAAATTCCATGCACTCAATCAGGAACCT
GGCACCAATGAAGAAATCTGCACATTTGCCAGAACCAAATTCAAAGTCACCTTCAAAATATTTGACAAGATTAATGTCAATGGATCCGAAACTATTCCACTTTACAATTTCCTAAAGAAG
GAAGGTGCTGGTTTTCTCGTTGATGCAGTAAAATGGAATTTTACCAAGTTTCTCGTTTCAAAGAGTGGAAAAGTATTGAAACGATATGCTCCGAATACTTCTCCGAAAGATATGGAAGAT
GATATTCAAAAATTGTTAAAGGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAACTGACTCTGATTTTTATTCATTTACTGTCAAGGATGCTGATTTAAATGATGTATCTATGGCTGATTATAAAGGAAAAGTAGTAATGATTGTGAATGTTGCCTCTAGATGTGGT
TTCACCAAACAGTACG
ACGAAATTCAAGAAGTTTATAACAAGTATAAGGATCAAGGTTTTGAAGTATTGGCATTCCCATGCAATCAATTCGGATCTCAAGAACCTGGCACCAATGAAGAA
ATCTGCACATTTGCCAGAACCAAATTCAAAGTCACCTTCAAAATATTTGACAAGATTAATGTCAATGGATCCGAAACTATTCCACTTTACAATTTCCTAAAGAAGGAAGGTGCTGGTTTT
CTCGTTGATGCAGTAAAATGGAATTTTACCAAGTTTCTCGTTTCAAAGAGTGGAAAAGTATTGAAACGATATGCTCCGAATACTTCTCCGAAAGATATGGAAGATGATATTCAAAAATTG
TTAAAGGAATAA

Retrieve as FASTA