Entry information : NgrGPx03
Entry ID 11095
Creation 2012-05-30 (Christophe Dunand)
Last sequence changes 2012-05-30 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-20 (Qiang Li)
Peroxidase information: NgrGPx03
Name NgrGPx03
Class Other glutathione peroxidase    [Orthogroup: Gpx4001]
Taxonomy Eukaryota Heterolobosea Vahlkampfiidae Naegleria
Organism Naegleria gruberi    [TaxId: 5762 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NgrGPx03
start..stop
S start..stop
NgrGPx06 283 8e-100 1..162 1..162
NgrGPx02 245 8e-85 2..162 3..163
NgrGPx07 235 5e-81 1..162 1..162
ThasGPx02 192 5e-64 7..162 10..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 514405..514620 216 N° 2 514033..514305 273  
complement(join(514033..514305,514405..514620))


exon

Literature and cross-references NgrGPx03
DNA ref. GenBank:   GG738855.1 (514620..514033)
Protein sequence: NgrGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   18276.32  
PI (pH):   %s   8.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTESEFYSFTVPDAQGNEVSLSDYKGKVVMVVNVASSCGLTPQYEGLQALYDKYKDQGFEIIAFPCNQFAFQERGSNDEICAFARNKFKVSFKIFAKTHVNGSETIPLYKYLKKEGEGKLFKAIKWNFTKFLVSKTGKVLKRYSPNTEPSEIEQDIVKLLSE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAGAATCCGAATTTTACAGTTTCACCGTTCCTGATGCTCAAGGTAATGAAGTTTCCCTCTCCGATTACAAGGGAAAAGTTGTGATGGTAGTGAATGTCGCAAGTAGTTGTGGGTTG
ACTCCGCAGTATGAAGGTTTGCAAGCTTTATATGATAAGTATAAAGATCAAGGATTTGAAATTATTGCATTCCCTTGTAATCAGTTTGCTTTCCAA
GTAAGTTTCTAATAGAATTTGAAT
TTCGAATAAGTTTCTAATAATTTTTATTATTTTTATTCTACTAATTAAATTAATCTATTAATATATTCTGTGTAGGAAAGAGGATCGAATGATGAAATTTGTGCATTCGCAAGAAACAAA
TTTAAAGTTTCTTTCAAAATATTCGCCAAAACACATGTCAATGGCAGTGAAACTATTCCTCTCTATAAATATCTTAAAAAGGAAGGAGAAGGCAAACTATTCAAAGCAATTAAATGGAAT
TTCACTAAATTTTTAGTTTCCAAAACAGGAAAAGTACTAAAAAGATATTCTCCAAATACAGAACCTTCCGAAATTGAACAAGATATTGTAAAATTACTTTCTGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAGAATCCGAATTTTACAGTTTCACCGTTCCTGATGCTCAAGGTAATGAAGTTTCCCTCTCCGATTACAAGGGAAAAGTTGTGATGGTAGTGAATGTCGCAAGTAGTTGTGGGTTG
ACTCCGCAGTATGAAGGTTTGCAAGCTTTATATGATAAGTATAAAGATCAAGGATTTGAAATTATTGCATTCCCTTGTAATCAGTTTGCTTTCCAA
GAAAGAGGATCGAATGATGAAATT
TGTGCATTCGCAAGAAACAAATTTAAAGTTTCTTTCAAAATATTCGCCAAAACACATGTCAATGGCAGTGAAACTATTCCTCTCTATAAATATCTTAAAAAGGAAGGAGAAGGCAAACTA
TTCAAAGCAATTAAATGGAATTTCACTAAATTTTTAGTTTCCAAAACAGGAAAAGTACTAAAAAGATATTCTCCAAATACAGAACCTTCCGAAATTGAACAAGATATTGTAAAATTACTT
TCTGAATAA

Retrieve as FASTA