Entry information : NgrGPx05
Entry ID 11097
Creation 2012-05-30 (Christophe Dunand)
Last sequence changes 2012-05-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-30 (Christophe Dunand)
Peroxidase information: NgrGPx05
Name NgrGPx05
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3002]
Taxonomy Eukaryota Heterolobosea Vahlkampfiidae Naegleria
Organism Naegleria gruberi    [TaxId: 5762 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NgrGPx05
start..stop
S start..stop
NgrGPx03 168 6e-55 1..144 21..162
NgrGPx07 167 1e-54 1..144 21..162
NgrGPx06 166 4e-54 1..144 21..162
NgrGPx02 165 1e-53 1..144 22..163
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 156321..156393 73 N° 2 155883..156244 362  
complement(join(155883..156244,156321..156393))


exon

Literature and cross-references NgrGPx05
DNA ref. GenBank:   GG738888.1 (156393..155883)
Protein sequence: NgrGPx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   144
PWM (Da):   %s   16107.23  
PI (pH):   %s   8.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSEMRGKVCLIVNVASNCGFTPQYKGLQELYDKYGKDGKFEVIAFPSNSFNQEKGSTEEICAFTKDRFKVTFKIMEKIEVNGDNAHPIYQFLKQEGPGGFLGSTNIKWNFTKFLINKEGKVIGRYAPTTDPLSIAKDIEKALKD

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGAAATGAGAGGGAAAGTGTGCTTGATTGTTAATGTTGCTTCAAATTGTGGTTTTACTCCTCAGTACAGTAAGTAGAATATATTATATTATATAATAATTTGATAATCATATTAA
TATATATATTATTAATTAAATATTGTTAGAGGGACTACAAGAATTATATGACAAGTACGGGAAGGATGGCAAATTTGAAGTCATTGCCTTCCCTTCCAACTCTTTCAATCAGGAAAAGGG
TTCCACAGAAGAAATCTGTGCATTCACCAAAGATCGTTTCAAAGTAACCTTCAAAATCATGGAGAAGATTGAAGTGAATGGTGACAATGCTCACCCAATTTACCAATTCTTAAAGCAAGA
AGGACCTGGAGGATTTCTCGGATCAACCAATATCAAGTGGAACTTTACCAAATTCCTCATCAATAAGGAAGGAAAAGTAATTGGAAGATATGCTCCAACAACTGATCCTCTTTCTATTGC
AAAAGATATTGAGAAAGCTTTAAAGGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGAAATGAGAGGGAAAGTGTGCTTGATTGTTAATGTTGCTTCAAATTGTGGTTTTACTCCTCAGTACAAGGGACTACAAGAATTATATGACAAGTACGGGAAGGATGGCAAATTT
GAAGTCATTGCCTTCCCTTCCAACTCTTTCAATCAGGAAAAGGGTTCCACAGAAGAAATCTGTGCATTCACCAAAGATCGTTTCAAAGTAACCTTCAAAATCATGGAGAAGATTGAAGTG
AATGGTGACAATGCTCACCCAATTTACCAATTCTTAAAGCAAGAAGGACCTGGAGGATTTCTCGGATCAACCAATATCAAGTGGAACTTTACCAAATTCCTCATCAATAAGGAAGGAAAA
GTAATTGGAAGATATGCTCCAACAACTGATCCTCTTTCTATTGCAAAAGATATTGAGAAAGCTTTAAAGGATTAA

Retrieve as FASTA