Entry information : NgrGPx06
Entry ID 11098
Creation 2012-05-30 (Christophe Dunand)
Last sequence changes 2012-05-30 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-20 (Qiang Li)
Peroxidase information: NgrGPx06
Name NgrGPx06
Class Other glutathione peroxidase    [Orthogroup: Gpx4001]
Taxonomy Eukaryota Heterolobosea Vahlkampfiidae Naegleria
Organism Naegleria gruberi    [TaxId: 5762 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NgrGPx06
start..stop
S start..stop
NgrGPx03 283 8e-100 1..162 1..162
NgrGPx02 241 2e-83 2..162 3..163
NgrGPx07 229 1e-78 1..162 1..162
LllGPx01_IL1403 194 6e-65 6..160 3..157
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 225341..225556 216 N° 2 225641..225913 273  
join(225341..225556,225641..225913)


exon

Literature and cross-references NgrGPx06
DNA ref. GenBank:   GG738908.1 (225341..225913)
Protein sequence: NgrGPx06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   18329.19  
PI (pH):   %s   7.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTESEFYSFVVPDAQGNDVKLSDYKGKVVMVVNVASSCGKTPQYAGLQKLYEKYKDQGLEILAFPCNQFAFQERGSNEEICTFTRDKYKVTFKMFAKTTVNGGDTIPLYQYLKKEGEGSLFNAIKWNFTKFLVSKSGKVLQRYSPNTEPEDMEEDIKKLLAE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAGAATCTGAATTTTACAGCTTTGTTGTGCCAGATGCTCAAGGCAATGACGTTAAACTCTCCGACTACAAGGGAAAGGTAGTGATGGTTGTGAATGTTGCCAGCAGTTGTGGTAAA
ACACCTCAATATGCAGGATTGCAAAAGTTATATGAAAAGTACAAGGATCAAGGATTGGAAATTTTGGCATTCCCTTGCAATCAATTTGCTTTCCAA
GTAAGTTGTCATCCCGATCATCAA
TTTAATTACTTTAATGATAATTATTATTCCGATCAATTTAATATAATAATTAATTAATAGGAAAGAGGATCTAATGAAGAAATTTGTACATTCACAAGAGACAAGTACAAGGTGACTTTC
AAAATGTTTGCCAAAACAACTGTCAATGGAGGTGATACTATTCCTCTCTACCAGTACTTGAAGAAGGAAGGAGAAGGTTCTCTCTTCAATGCCATCAAGTGGAATTTTACTAAATTCTTG
GTTTCTAAAAGTGGAAAGGTCTTACAAAGATATTCTCCAAATACTGAACCTGAAGATATGGAAGAAGATATCAAGAAATTACTTGCTGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAGAATCTGAATTTTACAGCTTTGTTGTGCCAGATGCTCAAGGCAATGACGTTAAACTCTCCGACTACAAGGGAAAGGTAGTGATGGTTGTGAATGTTGCCAGCAGTTGTGGTAAA
ACACCTCAATATGCAGGATTGCAAAAGTTATATGAAAAGTACAAGGATCAAGGATTGGAAATTTTGGCATTCCCTTGCAATCAATTTGCTTTCCAA
GAAAGAGGATCTAATGAAGAAATT
TGTACATTCACAAGAGACAAGTACAAGGTGACTTTCAAAATGTTTGCCAAAACAACTGTCAATGGAGGTGATACTATTCCTCTCTACCAGTACTTGAAGAAGGAAGGAGAAGGTTCTCTC
TTCAATGCCATCAAGTGGAATTTTACTAAATTCTTGGTTTCTAAAAGTGGAAAGGTCTTACAAAGATATTCTCCAAATACTGAACCTGAAGATATGGAAGAAGATATCAAGAAATTACTT
GCTGAATAA

Retrieve as FASTA