Entry information : BnaAPx-CcP
Entry ID 11106
Creation 2012-06-04 (Christophe Dunand)
Last sequence changes 2012-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-04 (Christophe Dunand)
Peroxidase information: BnaAPx-CcP
Name BnaAPx-CcP
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Bigelowiella
Organism Bigelowiella natans    [TaxId: 227086 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BnaAPx-CcP
start..stop
S start..stop
PparCcP01 283 1e-96 10..263 12..273
EgraAPx-CcP01 291 4e-95 9..260 130..382
EgraAPx-CcP01 286 3e-93 7..260 385..639
EUgAPx-CcP03 276 2e-94 16..260 1..245
EhuxAPx-CcP04 276 9e-94 10..260 1..253
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 87868..88118 251 N° 2 88316..88587 272 N° 3 88784..89076 293  
join(87868..88118,88316..88587,88784..89076)


exon

Literature and cross-references BnaAPx-CcP
DNA ref. JGI genome:   scaffold_68 (87868..89076)
Cluster/Prediction ref. JGI gene:   42846
Protein sequence: BnaAPx-CcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   272
PWM (Da):   %s   29416.25  
PI (pH):   %s   4.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFATATDLKLDWAGLKNDLATMIKAKECGPIMIRLSWHDAGTYCKADNSGGARGAQRFEEGESQHGANAGLDVAIGLLKDIQEKYPISAADLWAFASCVATEVMGGPKIAFRAGRDDIPDPTGCVEEGRLPDADKGSDHLRSVFGRMGFSDKDIVVLSGAHTVGRCHGDRSGFGAWTEAPLQWDNAYFKNIMSKSYAAETTAAGNPQYRNADADIIALETDLALTTDPEFKKYTEEFANDAEAFNKAYAETYQKLQELGWGSKGLTEIAW

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCCACAGCGACCGATTTGAAACTTGACTGGGCTGGTCTTAAAAATGATCTTGCAACAATGATCAAAGCAAAAGAATGCGGGCCTATTATGATCCGGCTTTCTTGGCATGATGCT
GGTACCTACTGTAAGGCTGACAACAGTGGAGGAGCAAGAGGTGCTCAGCGTTTTGAAGAGGGAGAATCTCAGCATGGCGCCAATGCTGGACTTGACGTTGCAATTGGCCTCTTGAAGGAC
ATCCAGGAGAA
GTAATTTATCATTTTTTTCGTAAATCTTGAATCAAAGATTGAACTGTTTAACTTCGAGAACAAAGACTGCTTAATTAATTCTTAACTTTATGATTTTGGTGAGCTAAGC
TTATCGCTGAGTGCCCAAACACATCATATATATATCATGTATTCAAATCTGTTTTCTAACTATATCTCCTCGCTACCCCTATCTCCAGATATCCCATCAGCGCTGCCGACCTTTGGGCAT
TTGCTTCATGTGTAGCAACGGAGGTGATGGGAGGACCAAAGATTGCTTTCCGTGCTGGGCGTGACGATATTCCTGATCCAACCGGCTGTGTTGAAGAAGGAAGGCTTCCCGACGCTGATA
AGGGCTCAGACCATCTGCGATCTGTATTTGGACGAATGGGCTTCAGTGACAAGGATATCGTTGTCCTTTCTGGGGCACATACCGTTGGAAGGTGCCATGGAGACCGAAGTGGTTTCGAAG
GTAGCGATGAATAGTAATACTAGCAACACAATGCTACTATGTCCTGGTTTGCGCAACGTATGCAATATTCGATTCCCATATTATCAACTGCGCATTGAGGCATGCTCATAAAATGGAAGT
CTTTCCACAGTTCAGATTCTGGATTATTTCTATTCACAGCCACTATATCCTCATTGCTTGGTTTGTATTGTTTAAGGTGCATGGACTGAGGCTCCTCTTCAATGGGACAACGCCTACTTC
AAGAACATAATGTCGAAGAGCTACGCAGCGGAAACCACTGCTGCTGGCAACCCGCAGTACAGAAATGCCGATGCTGATATCATCGCTTTGGAAACAGACCTTGCTCTCACTACTGATCCT
GAATTCAAGAAGTACACAGAGGAGTTTGCCAATGATGCTGAAGCTTTCAACAAGGCTTACGCTGAAACCTATCAAAAGCTGCAGGAACTTGGCTGGGGAAGCAAGGGCCTCACTGAAATT
GCTTGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCCACAGCGACCGATTTGAAACTTGACTGGGCTGGTCTTAAAAATGATCTTGCAACAATGATCAAAGCAAAAGAATGCGGGCCTATTATGATCCGGCTTTCTTGGCATGATGCT
GGTACCTACTGTAAGGCTGACAACAGTGGAGGAGCAAGAGGTGCTCAGCGTTTTGAAGAGGGAGAATCTCAGCATGGCGCCAATGCTGGACTTGACGTTGCAATTGGCCTCTTGAAGGAC
ATCCAGGAGAA
ATATCCCATCAGCGCTGCCGACCTTTGGGCATTTGCTTCATGTGTAGCAACGGAGGTGATGGGAGGACCAAAGATTGCTTTCCGTGCTGGGCGTGACGATATTCCTGAT
CCAACCGGCTGTGTTGAAGAAGGAAGGCTTCCCGACGCTGATAAGGGCTCAGACCATCTGCGATCTGTATTTGGACGAATGGGCTTCAGTGACAAGGATATCGTTGTCCTTTCTGGGGCA
CATACCGTTGGAAGGTGCCATGGAGACCGAAGTGGTTTCGAAG
GTGCATGGACTGAGGCTCCTCTTCAATGGGACAACGCCTACTTCAAGAACATAATGTCGAAGAGCTACGCAGCGGAA
ACCACTGCTGCTGGCAACCCGCAGTACAGAAATGCCGATGCTGATATCATCGCTTTGGAAACAGACCTTGCTCTCACTACTGATCCTGAATTCAAGAAGTACACAGAGGAGTTTGCCAAT
GATGCTGAAGCTTTCAACAAGGCTTACGCTGAAACCTATCAAAAGCTGCAGGAACTTGGCTGGGGAAGCAAGGGCCTCACTGAAATTGCTTGGTAA

Retrieve as FASTA