Entry information : BnaCcP03
Entry ID 11107
Creation 2012-06-04 (Christophe Dunand)
Last sequence changes 2012-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-04 (Christophe Dunand)
Peroxidase information: BnaCcP03
Name BnaCcP03
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Bigelowiella
Organism Bigelowiella natans    [TaxId: 227086 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BnaCcP03
start..stop
S start..stop
CatmCcP01_UTEX2591 350 2e-121 1..285 48..329
CspCcP06 342 3e-119 21..285 28..292
CatmCcP01_M2923 342 2e-118 8..285 53..330
CsubCcP01 341 8e-118 32..285 87..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 334117..334319 203 N° 2 333846..334012 167 N° 3 333687..333713 27 N° 4 333489..333613 125
N° 5 333306..333354 49 N° 6 332932..333102 171 N° 7 332515..332558 44 N° 8 332316..332387 72
complement(join(332316..332387,332515..332558,332932..333102,333306..333354,3334 89..333613,333687..333713,333846..334012,334117..334319))


exon

Literature and cross-references BnaCcP03
DNA ref. GenBank:   scaffold_4 (334319..332316)
Cluster/Prediction ref. JGI transcript:   57114
Protein sequence: BnaCcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   286
PWM (Da):   %s   31556.55  
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGYGVGASGVALLAQGLFRRGIAEEGKAETFDYSAVRKAVADKLDNLDYDDGSYGPVLVRLAWHSSGTFSVFDNSGGSCGATMRFQPEADDPANAGLDVARDLLEPIKAQFPEISYSDLWTLGCVAIEELGGPHIDWTPGRTDKKCKHCCPPVGRLPDASRNADHLRAVFYRGLSDQEIVALSGAHVLGRCHTSRSGYDGPWVRSPTTFSNEYFKRLHDTKWTIREWNGPLQYQNPENDLMMLPTDLELIRDPIFAPYAAYAKDQDLFFKDFAAAFKKLIEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGATATGGTGTGGGCGCTTCTGGTGTGGCACTGCTCGCGCAAGGCTTGTTTCGTCGTGGAATTGCGGAGGAAGGGAAGGCTGAAACCTTCGACTATTCCGCCGTTAGAAAGGCCGTG
GCTGACAAGTTGGATAATCTGGACTACGATGATGGTAGCTACGGGCCTGTCCTTGTCCGGCTTGCCTGGCACTCCAGTGGAAC
GTAGTAGCCTCAATAATATCTACGACAAAGACATGAT
GTAGTGATGATGAATATATAAAGCGCAACGGAACGGAACAAGATTTAAGACTAGAGTTTGTGTGCAGGTTCTCCGTATTCGACAATTCTGGTGGATCATGCGGCGCAACTATGCGATTCC
AGCCGGAGGCTGATGATCCAGCAAATGCGGGTCTCGATGTGGCAAGAGACCTTCTCGAGCCAATTAAGGCCCAATTCCCAGAGATCTCTTACTCAGATCTATGGACTCTTGCAG
GTATCA
TCACCCAAATCATTTTTTTGAAAAACAAAATCATAATGAAAGGGAAGGGGAGGAGGGAGGTATATCACATTTCTCTCGAGCGAGCGAGCGATAAAAGTCAATAACGGGATGACATCGTTG
GATTAGGATGCGTCGCCATCGAAGAGCTCGGAGGTCACTTAAAAAATTGCATTCCCGACATCATCTCATGCTAAATTGATAATATTTACGTCTATGCACCGCATAGGACCGCACATTGAT
TGGACACCTGGGCGCACGGACAAGAAATGCAAGCATTGTTGTCCACCCGTGGGGCGACTGCCTGATGCCTCTAGGAATGCAGACCATCTCCGTGCCGTTTTCTACAGAATG
GTGTGTGCA
AATTGCCACACAGTATGATACGCAAATGATGTTTCCTTTCCCTCGAGAAAGTGTTAATTATCAGCGCATGCGATCCGTTCAAAACCATCGAATGCCATGAGCTGACAACAAAACGCAAAA
AACAGGGATTGTCGGATCAGGAGATTGTTGCCCTTTCTGGCGCCCATGTTCTTGGTATATTCATAAATTTGAAAAAAAATCCTCCCGAACCCGTCCCTAACCCGAACTCCATATCAATAA
CTTGCGCGAACGTGCGTTTTAGAATTCATTTTGCACCACATAGTCTCCCGGCTTGATCAAAGGAAGCCATAAAGATCCACCACTTCGAGTTTTCTTACAGAGAGCTCATTCCGAATCCTT
CCCTATCCTACTAATAGGTCGGTGCCATACAAGTCGAAGTGGCTACGATGGGCCTTGGGTGCGGTCTCCGACGACGTTCTCCAATGAGTACTTCAAGCGTTTGCACGACACCAAGTGGAC
GATCAGGGAGTGGAATGGCCCCCTTCAATATCAAAACCCTGAAAATGATCTCATGATGCTTCCGACCG
GTTATATTGATTTTTGCTCTACTCTTCGATGAGGAGGGAGAAGGAAGAGGAG
GAGGAGGAGGATACTAGATTTACGCGTACCATGATTCCTTAGCCCCTCCAACTTGTCTCTCTATTCGTATGCCCTGCTTCCAATAGGAGAGGCGGGGGGATGATGATTGGCCTTTGATTC
AATTATTTGTGCCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTATTGTACAATATAAGTATCGACGGTTTCTGTAATTAAATATAGAGGAGGGGGAAATGATCCATTCACGGACAG
CACTGATGATACAATGATGACAATGATTGCACTGTAGGTCTTAAATCAATATGAAGAGATGTGTGTTGTTCATTTTCTTAGATCTGGAGCTCATTCGCGATCCAATATTTGCCCCTTACG
CACAA
GTTAGGACACATAATGATAGTTTATGTTTTGTTTATTTCCCCTGTCTAGTTTTTTAGTTGTGGTAACAAGTATATCTGAATATTCAACTTAAGTCCCATCAAATTGATCGAGTAA
TTGACTCATTAGGCGTATGCAAAGGACCAGGATCTTTTTTTCAAAGATTTTGCTGCTGCTTTCAAGAAGCTGATAGAGCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGATATGGTGTGGGCGCTTCTGGTGTGGCACTGCTCGCGCAAGGCTTGTTTCGTCGTGGAATTGCGGAGGAAGGGAAGGCTGAAACCTTCGACTATTCCGCCGTTAGAAAGGCCGTG
GCTGACAAGTTGGATAATCTGGACTACGATGATGGTAGCTACGGGCCTGTCCTTGTCCGGCTTGCCTGGCACTCCAGTGGAAC
GTTCTCCGTATTCGACAATTCTGGTGGATCATGCGGC
GCAACTATGCGATTCCAGCCGGAGGCTGATGATCCAGCAAATGCGGGTCTCGATGTGGCAAGAGACCTTCTCGAGCCAATTAAGGCCCAATTCCCAGAGATCTCTTACTCAGATCTATGG
ACTCTTGCAG
GATGCGTCGCCATCGAAGAGCTCGGAGGACCGCACATTGATTGGACACCTGGGCGCACGGACAAGAAATGCAAGCATTGTTGTCCACCCGTGGGGCGACTGCCTGATGCC
TCTAGGAATGCAGACCATCTCCGTGCCGTTTTCTACAGAATG
GGATTGTCGGATCAGGAGATTGTTGCCCTTTCTGGCGCCCATGTTCTTGGTCGGTGCCATACAAGTCGAAGTGGCTAC
GATGGGCCTTGGGTGCGGTCTCCGACGACGTTCTCCAATGAGTACTTCAAGCGTTTGCACGACACCAAGTGGACGATCAGGGAGTGGAATGGCCCCCTTCAATATCAAAACCCTGAAAAT
GATCTCATGATGCTTCCGACCG
ATCTGGAGCTCATTCGCGATCCAATATTTGCCCCTTACGCACAAGCGTATGCAAAGGACCAGGATCTTTTTTTCAAAGATTTTGCTGCTGCTTTCAAG
AAGCTGATAGAGCTTTAG

Retrieve as FASTA