Entry information : BnaCcP05
Entry ID 11109
Creation 2012-06-04 (Christophe Dunand)
Last sequence changes 2012-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-04 (Christophe Dunand)
Peroxidase information: BnaCcP05
Name BnaCcP05
Class Cytochrome C peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Bigelowiella
Organism Bigelowiella natans    [TaxId: 227086 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BnaCcP05
start..stop
S start..stop
BnaCcP03 199 8e-62 65..274 32..257
AmaCcP 195 2e-59 65..274 98..326
AmaCcP02 194 3e-59 65..274 98..326
CowCcP01 187 2e-56 65..271 87..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1048637..1048735 99 N° 2 1048801..1048917 117 N° 3 1048979..1049057 79 N° 4 1049141..1049170 30
N° 5 1049291..1049434 144 N° 6 1049531..1049590 60 N° 7 1049664..1049720 57 N° 8 1049820..1049848 29
N° 9 1050049..1050160 112 N° 10 1050330..1050369 40 N° 11 1050731..1051103 373  
join(1048637..1048735,1048801..1048917,1048979..1049057,1049141..1049170,1049291 ..1049434,1049531..1049590,1049664..1049720,1049820..1049848,1050049..1050160,10 50330..1050369,1050731..1051103)


exon

Literature and cross-references BnaCcP05
DNA ref. JGI gene:   scaffold_12 (1048637..1051103)
Cluster/Prediction ref. JGI gene:   70618
Protein sequence: BnaCcP05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380
PWM (Da):   %s   41603.28 Transmb domain:   %s   i40-62o
PI (pH):   %s   9.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFAKIAKSFARNYIKPLRSKLFQTRTVAQKPKQMVHNDLATGVAATVTSLAAVAGGMYYFTQPNYSAIRAEIEELLDDLDYDDGSYGPVFVRLAWHNAGTYNMFDKTGGSEGAGMRFATEAKDPANAGLDIARARLEPIKQKYPEISYSDLWSLAGTVAIESLGGPKMKWVGGRKDNVSEELGPPAGRLPDAARGAIPTAVASRVLGCSPRPHSPTSTTESSLRTDGSRRSGMGRTSLKTLRFNEQLIFCLGTRGKLMMLPTDMAIIEDPIFNAVRGDVLQRRGIVLQRLCQGGSVETGYILCLVSKKYRSKFNFPSGMVQAATRGFHALDLLAFRNHAAYAQCNDDCELKSLVLIKRGAQFRYPHQEPLYARSRDL

Retrieve as FASTA  
Remarks Partial sequence from genomic (fragment is missing due to "n" in the sequence)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTTGCCAAGATTGCCAAGTCATTCGCCAGAAACTACATCAAGCCTCTGAGGAGCAAGTTGTTTCAAACGAGAACCGTGGCTCAGAAGCCGAAGGTCGTTCTCCTTCGTTTCTTG
GTTTCAATTGCTCCGCTGACCTGGTTGTGCGCCCCTTCTAAAAGCAGATGGTCCACAACGATCTGGCTACCGGTGTAGCTGCAACGGTTACATCGCTCGCAGCTGTAGCGGGGGGCATGT
ATTACTTTACCCAGCCAAACTACAGCGCGATTCGGGCTGAG
GTTTGAAACCCAATATGCTTTCCTGCCCGTCACTTGAATGATCATTGCATGTGAAACGCAGATCGAGGAGCTCCTTGAC
GACTTGGACTACGACGATGGAAGCTATGGCCCTGTCTTCGTCCGCCTTGCATGGCACAATG
GTACACTTGCTGATGCTTTCCACCGTTCAGCAGCACACCACACCGCCGCGTATTGAGGC
ATCATCGTGTTTCTTGATCATCAGCCGGGACCTATAACATGTTCGACAAGACAGGTATCTTGAATCACAGTTGGGGTCATTTTCGGCTGCCTTACTATTTCTTCCTCCTTCCCACCTTCC
CTCCCTTTGTTGGCCCCCCCCCTTACCCTTTCTCCTGTTCCCTCCATGTATCAGGGGGAAGCGAGGGCGCAGGCATGCGATTCGCAACGGAGGCCAAGGACCCAGCCAATGCAGGACTTG
ATATCGCACGGGCTCGTCTTGAACCAATAAAGCAGAAGTACCCTGAAATCTCGTACTCCGACCTCTGGTCCTTAGCAG
GTGGGAGCGTGCCAAAAGAGCTCAATCAATCGGCGAAAGCCG
AAGCAAGCTGAACTATTACTCACGCGATGTCCTTCCCTCTTTGTCGCATTGCAGGGACCGTCGCGATCGAGTCCCTTGGGGGACCAAAGATGAAGTGGGTTGGCGGCAGAAAAGGTGTGG
AGCGAACAACTTCCACCGATCATTGCTGAAAGGCGCACCTAATGTTGATCTTTCTCTCTCATACTAGACAACGTTTCCGAAGAGCTCGGCCCTCCAGCGGGCAGACTGCCTGATGCTGCA
CGCG
GTCTGCTAGTTTGTGCATTATCCCGTGCTTTTCTGGACTAAGAATATGGAATTCCCCCCCCCCCCCCCCCTCCCTCATGGCCATGTTAATGTCCAACAGGTGCCATACCGACCGCA
GTGGCTTCAAGG
GTAGGCACTAATAGGATATCAATAACAGCATAAGAAGAATAGAATCGTATTGAATACGACGACTCGAGATCATGGAGATGGGATGGGGAGGGGTGTTCCTGATTTAAG
GCAAATCGCGCAATCTCTCACTGCGTAGCTGCTGACGTCCGTTCGGTTCTCTATTCCCCCTCCCCCCCCCTCCCCCCCTTCGCTTCCTGTAGGTCCTTGGGTGTTCTCCCCGACCACATT
CTCCAACGAGTACTACCGAGAGCTCTTTGAGAACCGATGGAAGCCGAAGAAGTGGAATGGGCCGCACCAGTTTGAAGACAAATC
GTGAGTGGAAGTTCCGTTCGCTAACGTTGATTTTGG
CATCAACCCTGTTCTTATGAAAGGATGGTTTTTCCTTCTCCCTCTCTCTCCCTCTGCCTCTCCCTCTCCCCCCCCAAAAACAGTGTACCCCCCCCCCCCCCCCCAAGACGTTGTTTTTTT
CTAAAAAAAAAAGTCCGCTTTAATGAGCAATTAATATTTTGTCTAGGAACACGGTAATAATAAGCGTTTATAGGGTGAGAACTTTCTTTGTGACTCTTGTGTTTCTTCCTCGGCGGCTCG
TATTCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCC
CCCCCCTCCCCCCCCCCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTGCGCGCAGGGGCAAGCTGATGATGCTTCCCACGGACATGGCAATTATCGAGGACCCGATCTTCAACGCCGTACG
CGGAGATGTACTACAAAGACGAGGAATTGTTCTTCAACGACTTTGCCAAGGTGGTAGTGTGGAAACCGGCTACATCCTTTGTCTTGTGTCGAAAAAATATAGGAGTAAATTCAATTTTCC
ATCAGGTATGGTACAAGCTGCAACACGTGGGTTTCACGCTTTAGATTTATTAGCCTTCCGTAATCACGCCGCATATGCCCAGTGCAATGATGACTGCGAATTGAAGAGCTTGGTTTTGAT
TAAAAGAGGCGCACAATTTCGGTATCCGCACCAAGAACCTCTCTATGCGCGTTCGCGAGATCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTTGCCAAGATTGCCAAGTCATTCGCCAGAAACTACATCAAGCCTCTGAGGAGCAAGTTGTTTCAAACGAGAACCGTGGCTCAGAAGCCGAAGCAGATGGTCCACAACGATCTG
GCTACCGGTGTAGCTGCAACGGTTACATCGCTCGCAGCTGTAGCGGGGGGCATGTATTACTTTACCCAGCCAAACTACAGCGCGATTCGGGCTGAG
ATCGAGGAGCTCCTTGACGACTTG
GACTACGACGATGGAAGCTATGGCCCTGTCTTCGTCCGCCTTGCATGGCACAATG
CCGGGACCTATAACATGTTCGACAAGACAGGGGGAAGCGAGGGCGCAGGCATGCGATTCGCAACG
GAGGCCAAGGACCCAGCCAATGCAGGACTTGATATCGCACGGGCTCGTCTTGAACCAATAAAGCAGAAGTACCCTGAAATCTCGTACTCCGACCTCTGGTCCTTAGCAG
GGACCGTCGCG
ATCGAGTCCCTTGGGGGACCAAAGATGAAGTGGGTTGGCGGCAGAAAAG
ACAACGTTTCCGAAGAGCTCGGCCCTCCAGCGGGCAGACTGCCTGATGCTGCACGCGGTGCCATACCGACC
GCAGTGGCTTCAAGG
GTCCTTGGGTGTTCTCCCCGACCACATTCTCCAACGAGTACTACCGAGAGCTCTTTGAGAACCGATGGAAGCCGAAGAAGTGGAATGGGCCGCACCAGTTTGAAG
ACAAATC
TCCGCTTTAATGAGCAATTAATATTTTGTCTAGGAACACGGGGCAAGCTGATGATGCTTCCCACGGACATGGCAATTATCGAGGACCCGATCTTCAACGCCGTACGCGGAGAT
GTACTACAAAGACGAGGAATTGTTCTTCAACGACTTTGCCAAGGTGGTAGTGTGGAAACCGGCTACATCCTTTGTCTTGTGTCGAAAAAATATAGGAGTAAATTCAATTTTCCATCAGGT
ATGGTACAAGCTGCAACACGTGGGTTTCACGCTTTAGATTTATTAGCCTTCCGTAATCACGCCGCATATGCCCAGTGCAATGATGACTGCGAATTGAAGAGCTTGGTTTTGATTAAAAGA
GGCGCACAATTTCGGTATCCGCACCAAGAACCTCTCTATGCGCGTTCGCGAGATCTGTAA

Retrieve as FASTA