Entry information : TmelCcP01
Entry ID 11112
Creation 2012-06-05 (Christophe Dunand)
Last sequence changes 2012-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-05 (Christophe Dunand)
Peroxidase information: TmelCcP01
Name TmelCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Pezizomycetes Tuberaceae Tuber
Organism Tuber melanosporum    [TaxId: 39416 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TmelCcP01
start..stop
S start..stop
TborCcP01 686 0 1..377 1..378
CvenCcP01 658 0 1..377 1..379
MimpCcP01 603 0 1..377 1..380
MconCcP01 603 0 1..377 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 123518..123910 393 N° 2 123977..124409 433 N° 3 124489..124796 308  
join(123518..123910,123977..124409,124489..124796)


exon

Literature and cross-references TmelCcP01
Protein ref. UniProtKB:   D5GL20
DNA ref. JGI genome:   scaffold_63 (123518..124796)
Cluster/Prediction ref. JGI gene:   6032 UniGene:   Tme.1513
Protein sequence: TmelCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378
PWM (Da):   %s   41336.79  
PI (pH):   %s   9.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASMARVLTRASKQASFTSTPLCRNFTTATRARPTTSIAAPIRQTGRRGYASGGSAGGGSSKIAIPLGLGLIGAGGYYAYTNDLLPAALSGAQASKTGGVLTPTKDDFQKVYNDVAELLENNDYDDGSYGPVVVRLGWHASGTYDKDTKTGGSNGATMRFAPESEHGANAGLKTARDLLEGIKKKHPWISYSDLWTLAAVAAIQEMGGPKIPWRPGRKDGDVSACTPDGRLPDATKEQKHLRAIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFSPTMLTNDYYKLLLEEKWAWKKWNGPKQFEDVSTKSLMMLPTDMALVKDKEFRKHVERYAKDNDLFFREFADAFGRLLELGVPFEKEEKFVFKSTTD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 12 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCATGGCCCGTGTTCTCACTCGCGCTTCGAAGCAAGCGTCCTTCACCTCCACTCCCCTCTGCCGCAATTTCACAACTGCGACCCGCGCTCGCCCGACCACCTCTATTGCCGCA
CCTATTAGACAGACTGGCCGCCGTGGATATGCTTCTGGCGGTTCAGCGGGTGGGGGTTCTAGCAAGATCGCTATCCCATTGGGTCTTGGTTTGATTGGTGCTGGTGGTTACTATGCTTAC
ACCAATGATCTTCTCCCCGCCGCATTGTCTGGCGCCCAGGCCTCGAAGACTGGCGGCGTGCTCACCCCCACTAAGGATGACTTTCAGAAGGTCTATAATGATGTTGCGGAGCTCTTGGAG
AATAATGATTACGACGATGGTTCCTATGGACCT
GTATGTATCCCAATTGTAAACCCCTTTAATGTTTGATGTTTAAATTGACAATTGTGTTGTAAAAAGGTAGTTGTCCGCCTTGGATGG
CACGCATCTGGAACTTATGACAAGGATACCAAGACTGGAGGTTCCAATGGGGCCACCATGCGTTTCGCTCCTGAGTCAGAGCATGGTGCAAATGCCGGCTTGAAGACCGCACGTGACCTT
CTCGAAGGTATCAAGAAGAAGCACCCTTGGATCTCGTACTCCGACCTCTGGACTCTTGCTGCTGTTGCTGCAATCCAGGAGATGGGTGGTCCCAAGATTCCGTGGAGACCCGGACGTAAG
GACGGTGACGTATCCGCTTGCACTCCTGATGGTCGTCTTCCCGACGCCACTAAGGAACAGAAGCATCTCAGAGCCATCTTCTACCGTATGGGTTTCAACGATCAGGAGATTGTCGCTTTA
TCGGGTGCCCACGCTCTCGGCAGATGCCACACCGATCGTTCCGGCTTTGATG
GTACGTTGTCCGCCTACTTTGTCACTCACACACCTACCCTGCGTTATCATTATAACCTCTAATACTAA
CGCATTGTTAGGTCCCTGGACTTTCTCGCCAACAATGCTGACAAACGATTACTACAAACTCTTGCTCGAGGAGAAGTGGGCCTGGAAGAAGTGGAATGGACCAAAGCAATTTGAGGATGT
TTCGACTAAATCTCTTATGATGCTTCCAACCGACATGGCGCTCGTCAAAGACAAGGAGTTTAGGAAGCATGTTGAGAGGTACGCCAAGGACAACGACCTCTTCTTCAGGGAGTTTGCGGA
TGCCTTTGGAAGACTGCTCGAGCTCGGTGTTCCTTTTGAGAAGGAGGAGAAGTTTGTTTTCAAGTCCACTACAGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCATGGCCCGTGTTCTCACTCGCGCTTCGAAGCAAGCGTCCTTCACCTCCACTCCCCTCTGCCGCAATTTCACAACTGCGACCCGCGCTCGCCCGACCACCTCTATTGCCGCA
CCTATTAGACAGACTGGCCGCCGTGGATATGCTTCTGGCGGTTCAGCGGGTGGGGGTTCTAGCAAGATCGCTATCCCATTGGGTCTTGGTTTGATTGGTGCTGGTGGTTACTATGCTTAC
ACCAATGATCTTCTCCCCGCCGCATTGTCTGGCGCCCAGGCCTCGAAGACTGGCGGCGTGCTCACCCCCACTAAGGATGACTTTCAGAAGGTCTATAATGATGTTGCGGAGCTCTTGGAG
AATAATGATTACGACGATGGTTCCTATGGACCT
GTAGTTGTCCGCCTTGGATGGCACGCATCTGGAACTTATGACAAGGATACCAAGACTGGAGGTTCCAATGGGGCCACCATGCGTTTC
GCTCCTGAGTCAGAGCATGGTGCAAATGCCGGCTTGAAGACCGCACGTGACCTTCTCGAAGGTATCAAGAAGAAGCACCCTTGGATCTCGTACTCCGACCTCTGGACTCTTGCTGCTGTT
GCTGCAATCCAGGAGATGGGTGGTCCCAAGATTCCGTGGAGACCCGGACGTAAGGACGGTGACGTATCCGCTTGCACTCCTGATGGTCGTCTTCCCGACGCCACTAAGGAACAGAAGCAT
CTCAGAGCCATCTTCTACCGTATGGGTTTCAACGATCAGGAGATTGTCGCTTTATCGGGTGCCCACGCTCTCGGCAGATGCCACACCGATCGTTCCGGCTTTGATG
GTCCCTGGACTTTC
TCGCCAACAATGCTGACAAACGATTACTACAAACTCTTGCTCGAGGAGAAGTGGGCCTGGAAGAAGTGGAATGGACCAAAGCAATTTGAGGATGTTTCGACTAAATCTCTTATGATGCTT
CCAACCGACATGGCGCTCGTCAAAGACAAGGAGTTTAGGAAGCATGTTGAGAGGTACGCCAAGGACAACGACCTCTTCTTCAGGGAGTTTGCGGATGCCTTTGGAAGACTGCTCGAGCTC
GGTGTTCCTTTTGAGAAGGAGGAGAAGTTTGTTTTCAAGTCCACTACAGATTAA

Retrieve as FASTA