Entry information : TmelGPx01
Entry ID 11113
Creation 2012-06-05 (Christophe Dunand)
Last sequence changes 2012-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-05 (Christophe Dunand)
Peroxidase information: TmelGPx01
Name TmelGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Pezizomycetes Tuberaceae Tuber
Organism Tuber melanosporum    [TaxId: 39416 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TmelGPx01
start..stop
S start..stop
ScocGPx01 191 2e-63 6..151 13..172
AoliGPx01 177 4e-58 1..157 1..173
CfulgGPx01 176 7e-57 2..150 56..216
AgoGPx 171 7e-55 3..148 26..185
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 800031..800147 117 N° 2 799821..799881 61 N° 3 799755..799791 37 N° 4 799561..799635 75
N° 5 799460..799504 45 N° 6 799382..799395 14 N° 7 799198..799325 128  
complement(join(799198..799325,799382..799395,799460..799504,799561..799635,7997 55..799791,799821..799881,800031..800147))


exon

Literature and cross-references TmelGPx01
Protein ref. UniProtKB:   D5GB16
DNA ref. JGI genome:   scaffold_19 (800147..799198)
Protein sequence: TmelGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   158
PWM (Da):   %s   17757.39  
PI (pH):   %s   9.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATTFYDLEPLDSRNQPYTFNQLKGKVVLIVNVASKYQYEGLEKLYEKYKDQGLEVLGARDRRGDPRCKRVNYGVKFPVLAKIDVNGGDASPVYKWLKDEKAGLLGIKLIKWNEKFLVSREGKVVDRYASTTKPDSLASAIEKELNKGTPPKAEL

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCTACCACTTTCTATGATCTTGAGCCCCTTGACTCTAGAAATCAACCCTATACCTTCAACCAGTTGAAAGGGAAGGTGGTTCTCATTGTCAATGTTGCTAGCAAGTACGTT
ACCCCCCTAACCTACTCCCCTCAGTCTCCGATAAAATTCCCCTTGTCGCTGACGACGACCGCATAGGTGCGGATTCACTCCCGTAAGTTCATTGAACTAAGATTTTCCTATTTGTCAGAT
GGTCAAGTTTACTCATCGGATAATAGCAATACGAGGGCCTTGAGAAACTTTACGAGAAGTACAAAGACCAGGGGCTCGAAGTGCTTGGTTTCCCGTGTAACCAGTTCGGTGGCCAGGAGC
CAGGGACAGACGAGGAGATCCAAGATGTAAGAG
GTTCCCTAACACTTCCAGATTGAAAACGACGACTTACTTACCCGTTACAGTTCTGCATGTAGGTTTTTTGTTATATCCTCTTTGTCT
TCACCTTAGCCTAGTGCTAACGGTGATTGAAGGGTCAATTACGGCGTTAAGTTCCCTGTTCTCGCCAAGATCGACGTCAACGGGGGTGATGCTTCTCCGGTCTACAAGTACTGCCCTCAA
CCTCCTTGATAGGGGCCTTTCATGAGCTAATGATATGGTATAGATGGCTCAAAGATGAGAAGGCGGGCCTTTTGGGAATAAAGCTCATGTAAGTCTCCCAGCCATATTGAGCTCTGCCTT
CTAGGTTCATCAACTAATAACTCCGCATTTAGAAAATGGAACTATGGTAAGAAATTACTGACACTTTGTGCGAGTATCCGATAATGTCTAATGCTTGTGCAGAGAAATTCCTCGTTTCCA
GGGAAGGAAAGGTGGTTGACCGCTATGCCTCCACTACGAAGCCCGACTCGTTGGCCTCTGCTATCGAGAAGGAGCTCAATAAGGGCACTCCCCCGAAAGCTGAATTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCTACCACTTTCTATGATCTTGAGCCCCTTGACTCTAGAAATCAACCCTATACCTTCAACCAGTTGAAAGGGAAGGTGGTTCTCATTGTCAATGTTGCTAGCAAGTACCAA
TACGAGGGCCTTGAGAAACTTTACGAGAAGTACAAAGACCAGGGGCTCGAAGTGCTTG
GAGCCAGGGACAGACGAGGAGATCCAAGATGTAAGAGGGTCAATTACGGCGTTAAGTTCCCT
GTTCTCGCCAAGATCGACGTCAACGGGGGTGATGCTTCTCCGGTCTACAA
ATGGCTCAAAGATGAGAAGGCGGGCCTTTTGGGAATAAAGCTCATAAAATGGAACTATGAGAAATTCCTC
GTTTCCAGGGAAGGAAAGGTGGTTGACCGCTATGCCTCCACTACGAAGCCCGACTCGTTGGCCTCTGCTATCGAGAAGGAGCTCAATAAGGGCACTCCCCCGAAAGCTGAATTGTAG

Retrieve as FASTA