Entry information : TmelPrxV02
Entry ID 11116
Creation 2012-06-05 (Christophe Dunand)
Last sequence changes 2012-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-05 (Christophe Dunand)
Peroxidase information: TmelPrxV02
Name TmelPrxV02
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Fungi Ascomycota Pezizomycetes Tuberaceae Tuber
Organism Tuber melanosporum    [TaxId: 39416 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TmelPrxV02
start..stop
S start..stop
SbrePrxV01 166 1e-53 2..156 25..178
SlutPrxV01 165 3e-53 2..156 25..178
UmPrxV 159 7e-51 20..156 33..172
SjapPrxV01 156 6e-50 1..156 1..155
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 739667..739793 127 N° 2 739492..739589 98 N° 3 739355..739424 70 N° 4 739173..739285 113
N° 5 739055..739117 63  
complement(join(739055..739117,739173..739285,739355..739424,739492..739589,7396 67..739793)


exon

Literature and cross-references TmelPrxV02
Protein ref. UniProtKB:   D5GHW8
DNA ref. JGI gene:   scaffold_42 (739793..739055)
Cluster/Prediction ref. JGI gene:   4930
Protein sequence: TmelPrxV02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   156
PWM (Da):   %s   16454.48  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISVGSSIPAAPASLWVEKDNNTVSLPSSGKYIIVGVPGAFTPPCSSHVPGYVENYDKLQAKGISAVYVVAVNDFVVNAWKEQLAKGSSVHFLSDSKGEFTRLVGLDFDASGLLGNARSQRYVAVVEDGKVTNLVENEAPNITVTHVDKILSSL*

Retrieve as FASTA  
Remarks Comlpete sequence from genomic (4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTCAGTCGGCTCGTCAATTCCTGCTGCCCCTGCGAGCCTCTGGGTTGAGAAGGATAATAATACCGTCTCGCTCCCATCCAGCGGAAAGTACATTATCGTTGGTGTGCCAGGAGCC
TTCACTC
GTTAGTTGCCCCTTCACACCCAATTAAGTTCGTACGAGTACGGAGAAGTTCTAACAAAGCATTTTCGATGCGGTTAGCTCCTTGCTCGTCGCATGTTCCTGGATACGTTGAAA
ACTACGACAAGCTTCAGGCGAAGGGTATCAGTGCTGTTTACGTTGTCGCCGTTAACGATATT
GTAAGTTTCTTGCATCTCTTAACTCTTGATTTGATCTAATTGTGATTAATTCGTTGTT
GTATGCCAGTTCGTCGTGAACGCTTGGAAGGAGCAGCTTGCCAAGGGCTCTAGCGTCCATTTCCTTTCGGATTCCAAAGGTATGCTGATAATCTAAATTTCATTGGGTAATGGGCATTCA
ATACTAATTTTGCATATCTGTGGGATAGGCGAATTCACTAGATTGGTTGGGCTCGATTTTGATGCCAGTGGATTGCTTGGAAACGCACGCTCCCAGAGATACGTCGCCGTCGTTGAGGAC
GGAAAGGTCACCAACCTTCAA
GTATGCCCTATAGTGTCTTAAGTCACGAACTTGTGAACTGATTTTTGACAAACAGGTCGAGAATGAAGCCCCCAACATCACTGTCACCCATGTAGACAA
GATTCTCAGCAGTTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTCAGTCGGCTCGTCAATTCCTGCTGCCCCTGCGAGCCTCTGGGTTGAGAAGGATAATAATACCGTCTCGCTCCCATCCAGCGGAAAGTACATTATCGTTGGTGTGCCAGGAGCC
TTCACTC
CTCCTTGCTCGTCGCATGTTCCTGGATACGTTGAAAACTACGACAAGCTTCAGGCGAAGGGTATCAGTGCTGTTTACGTTGTCGCCGTTAACGATATTTTCGTCGTGAACGCT
TGGAAGGAGCAGCTTGCCAAGGGCTCTAGCGTCCATTTCCTTTCGGATTCCAAAG
GCGAATTCACTAGATTGGTTGGGCTCGATTTTGATGCCAGTGGATTGCTTGGAAACGCACGCTCC
CAGAGATACGTCGCCGTCGTTGAGGACGGAAAGGTCACCAACCTTCAA
GTCGAGAATGAAGCCCCCAACATCACTGTCACCCATGTAGACAAGATTCTCAGCAGTTTGTAA

Retrieve as FASTA