Entry information : MpiCcP02
Entry ID 11120
Creation 2012-06-06 (Christophe Dunand)
Last sequence changes 2012-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-06 (Christophe Dunand)
Peroxidase information: MpiCcP02
Name MpiCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella pini (Dothistroma septosporum )    [TaxId: 64363 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpiCcP02
start..stop
S start..stop
CzmCcP 558 0 1..366 1..362
ZcelCcP02 541 0 1..367 1..366
ApulCcP01 498 4e-178 1..367 1..359
BdotCcP01 496 3e-177 1..364 1..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1973982..1974359 378 N° 2 1973147..1973872 726  
complement(join(1973147..1973872,1973982..1974359))


exon

Literature and cross-references MpiCcP02
DNA ref. JGI genome:   scaffold_5 (1974359..1973147)
Cluster/Prediction ref. JGI gene:   72130
Protein sequence: MpiCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368
PWM (Da):   %s   41013.15  
PI (pH):   %s   8.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTGRSFARALRSTPASQPFRSSATRQSIACSFQQQARRGYSNSGSQSPNNSRYIWSSAAAGLSLVVAGYFTLVKKHGPLAEESAKPFTPTKDDYQEVYDAIAAKLIKEDDYDDGSYGPVLLRLGWHASGTYDAQTKTGGSNGATMRFAPEKDHGANSGLHIAQDFLESIKKQFPWITYSDLWTLAAVCAVQEMGGPDIPWRPGRSDRDVSFCTPDGRLPDGSKEQNHLRAIFGRMGFNDQEIVALSGAHALGRCHTDRSGFSGPWTFSPITLTNDYYKLLFDEKWQWKKWGGPKQYEDTGSKTLMMLPTDMAITKDKSMRKWAEVYAKDQEKFFQDFSNVVCKLFELGVPFETDEGTRIRFKRTE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGACAGGCAGATCATTCGCGCGGGCGTTACGCTCAACACCAGCAAGCCAACCTTTCAGGTCATCCGCGACACGTCAATCGATAGCCTGTAGCTTCCAGCAACAAGCACGCCGT
GGCTACTCCAACTCCGGATCGCAGTCTCCAAACAACAGTCGCTACATATGGTCCAGCGCCGCAGCAGGTCTTTCTCTCGTCGTAGCAGGCTACTTCACCTTGGTGAAGAAACACGGACCG
CTCGCCGAAGAAAGTGCCAAACCCTTCACACCCACCAAAGATGACTACCAAGAGGTGTACGACGCTATAGCAGCGAAGCTAATCAAAGAAGATGACTACGACGACGGTTCGTACGGACCA
GTTCTCCTTCGTCTAGGC
GTAAGCAAGGTCCCGCACAGAAGCACTATCTCGATACCTGAGACATCATCCTCAGACGCTCGGCTTCTGTGCTTCAATCTAGACACATGCTGACATACCTGC
CCTTCAGTGGCACGCCTCGGGCACCTACGACGCTCAAACTAAGACCGGCGGCTCCAACGGCGCGACCATGCGCTTTGCCCCCGAAAAGGACCACGGCGCGAACTCAGGTCTTCACATAGC
TCAGGACTTCCTCGAGTCAATCAAGAAGCAGTTCCCCTGGATCACATACTCTGACCTCTGGACCCTTGCCGCAGTCTGCGCAGTCCAAGAGATGGGCGGTCCGGACATTCCCTGGCGTCC
AGGCCGCAGCGATCGTGACGTTTCATTCTGCACTCCCGATGGTCGCCTTCCAGATGGATCGAAGGAGCAGAACCACCTCCGCGCCATCTTCGGCCGCATGGGCTTCAACGACCAGGAAAT
CGTCGCCCTCTCTGGCGCGCACGCTCTTGGTCGTTGCCACACCGACAGAAGTGGCTTCTCCGGCCCCTGGACATTCTCACCCATCACTCTCACGAACGACTACTACAAACTCCTCTTTGA
CGAGAAGTGGCAGTGGAAAAAGTGGGGCGGGCCGAAGCAGTACGAGGATACAGGGAGCAAGACTCTGATGATGTTGCCGACGGATATGGCAATCACCAAGGACAAGAGTATGAGGAAGTG
GGCGGAGGTGTATGCGAAGGATCAGGAGAAGTTCTTCCAGGACTTCTCGAATGTGGTGTGTAAGCTGTTTGAGTTGGGGGTGCCGTTTGAGACGGACGAGGGCACGAGGATTAGATTCAA
GAGGACAGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGACAGGCAGATCATTCGCGCGGGCGTTACGCTCAACACCAGCAAGCCAACCTTTCAGGTCATCCGCGACACGTCAATCGATAGCCTGTAGCTTCCAGCAACAAGCACGCCGT
GGCTACTCCAACTCCGGATCGCAGTCTCCAAACAACAGTCGCTACATATGGTCCAGCGCCGCAGCAGGTCTTTCTCTCGTCGTAGCAGGCTACTTCACCTTGGTGAAGAAACACGGACCG
CTCGCCGAAGAAAGTGCCAAACCCTTCACACCCACCAAAGATGACTACCAAGAGGTGTACGACGCTATAGCAGCGAAGCTAATCAAAGAAGATGACTACGACGACGGTTCGTACGGACCA
GTTCTCCTTCGTCTAGGC
TGGCACGCCTCGGGCACCTACGACGCTCAAACTAAGACCGGCGGCTCCAACGGCGCGACCATGCGCTTTGCCCCCGAAAAGGACCACGGCGCGAACTCAGGT
CTTCACATAGCTCAGGACTTCCTCGAGTCAATCAAGAAGCAGTTCCCCTGGATCACATACTCTGACCTCTGGACCCTTGCCGCAGTCTGCGCAGTCCAAGAGATGGGCGGTCCGGACATT
CCCTGGCGTCCAGGCCGCAGCGATCGTGACGTTTCATTCTGCACTCCCGATGGTCGCCTTCCAGATGGATCGAAGGAGCAGAACCACCTCCGCGCCATCTTCGGCCGCATGGGCTTCAAC
GACCAGGAAATCGTCGCCCTCTCTGGCGCGCACGCTCTTGGTCGTTGCCACACCGACAGAAGTGGCTTCTCCGGCCCCTGGACATTCTCACCCATCACTCTCACGAACGACTACTACAAA
CTCCTCTTTGACGAGAAGTGGCAGTGGAAAAAGTGGGGCGGGCCGAAGCAGTACGAGGATACAGGGAGCAAGACTCTGATGATGTTGCCGACGGATATGGCAATCACCAAGGACAAGAGT
ATGAGGAAGTGGGCGGAGGTGTATGCGAAGGATCAGGAGAAGTTCTTCCAGGACTTCTCGAATGTGGTGTGTAAGCTGTTTGAGTTGGGGGTGCCGTTTGAGACGGACGAGGGCACGAGG
ATTAGATTCAAGAGGACAGAATAA

Retrieve as FASTA