Entry information : MbrAPx02
Entry ID 11126
Creation 2012-06-06 (Christophe Dunand)
Last sequence changes 2012-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-07 (Christophe Dunand)
Peroxidase information: MbrAPx02
Name MbrAPx02
Class Ascorbate peroxidase    [Orthogroup: APx006]
Taxonomy Eukaryota Codonosigidae Monosiga
Organism Monosiga brevicollis    [TaxId: 81824 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MbrAPx02
start..stop
S start..stop
CornAPx01 329 9e-116 12..239 1..226
CornAPx04 306 2e-106 12..239 1..229
GfiAPx02 305 3e-106 10..239 1..231
NhyAPx03 296 3e-102 12..239 18..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20..103 84 N° 2 209..886 678  
join(20..103,209..886)


exon

Literature and cross-references MbrAPx02
DNA ref. GenBank:   NW_001865045 (173238..174103) JGI genome:   scaffold_8 (173238..174103)
EST ref. GenBank:   FE872827.1 [5' end]
Cluster/Prediction ref. JGI gene:   18816
Protein sequence: MbrAPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   253
PWM (Da):   %s   27682.69  
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPVSAERRAELRQALTKLYDEVPCNPIMVRLGWHDAGTYDAESKTGGANASIRFDPEVTHGANAGLKWAIEKLQPIKDQFPDISYADLYQYASITAIAHAGGPKIPFRFGRPDAKDEDCTPDGRLPDANKGASHLRGDVFHRMGLTDKDIVALSGAHALGRGHKDRSGFEGPWTSEPLKFDNEYFSNVLAPKDDLLCLPSDKALASDPEFRPFVEKYATDKDAFFADYAVSHQKLSELGVKWTDSADAEATTD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTTTCCGCTGAACGTCGCGCTGAGCTGCGCCAGGCTCTGACCAAGCTGTACGACGAGGTGCCCTGCAACCCCATCATGGTACGAATGAATTTCGCGCATCCGCTTGGCCTTGGC
CTTTGCCTGCAAGATGTCAGGCAGCCACTCATCACTGCTCCTGGTCTTTTGGGATGTCAATGCACGTAGGTGCGTCTGGGCTGGCACGACGCTGGCACCTACGACGCCGAGTCCAAGACT
GGTGGCGCCAACGCTAGCATCCGCTTCGACCCCGAGGTCACGCACGGCGCCAACGCTGGTCTGAAGTGGGCCATTGAAAAGCTGCAGCCCATCAAGGACCAGTTCCCCGACATCTCCTAC
GCGGACCTTTACCAGTATGCTTCCATCACGGCCATTGCCCATGCTGGTGGCCCCAAGATTCCCTTCCGTTTCGGCCGCCCCGATGCCAAGGACGAGGACTGCACTCCCGACGGCCGTCTC
CCCGACGCCAACAAGGGCGCCAGCCACCTTCGTGGTGATGTTTTCCACCGCATGGGCCTGACGGACAAGGACATTGTGGCGCTCTCTGGTGCCCATGCCTTGGGCCGTGGTCATAAGGAC
CGCTCTGGCTTTGAGGGCCCCTGGACCTCGGAGCCCCTCAAGTTTGACAACGAGTACTTCTCCAACGTCCTCGCTCCCAAGGACGACCTGCTCTGCCTCCCCTCGGACAAGGCCCTTGCT
TCGGACCCCGAGTTCCGTCCCTTTGTCGAGAAGTACGCCACGGACAAGGATGCCTTCTTTGCCGACTACGCCGTCTCACACCAGAAGCTCAGCGAGCTCGGTGTCAAGTGGACCGACAGC
GCCGATGCCGAGGCCACCACCGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTTTCCGCTGAACGTCGCGCTGAGCTGCGCCAGGCTCTGACCAAGCTGTACGACGAGGTGCCCTGCAACCCCATCATGGTGCGTCTGGGCTGGCACGACGCTGGCACCTACGAC
GCCGAGTCCAAGACTGGTGGCGCCAACGCTAGCATCCGCTTCGACCCCGAGGTCACGCACGGCGCCAACGCTGGTCTGAAGTGGGCCATTGAAAAGCTGCAGCCCATCAAGGACCAGTTC
CCCGACATCTCCTACGCGGACCTTTACCAGTATGCTTCCATCACGGCCATTGCCCATGCTGGTGGCCCCAAGATTCCCTTCCGTTTCGGCCGCCCCGATGCCAAGGACGAGGACTGCACT
CCCGACGGCCGTCTCCCCGACGCCAACAAGGGCGCCAGCCACCTTCGTGGTGATGTTTTCCACCGCATGGGCCTGACGGACAAGGACATTGTGGCGCTCTCTGGTGCCCATGCCTTGGGC
CGTGGTCATAAGGACCGCTCTGGCTTTGAGGGCCCCTGGACCTCGGAGCCCCTCAAGTTTGACAACGAGTACTTCTCCAACGTCCTCGCTCCCAAGGACGACCTGCTCTGCCTCCCCTCG
GACAAGGCCCTTGCTTCGGACCCCGAGTTCCGTCCCTTTGTCGAGAAGTACGCCACGGACAAGGATGCCTTCTTTGCCGACTACGCCGTCTCACACCAGAAGCTCAGCGAGCTCGGTGTC
AAGTGGACCGACAGCGCCGATGCCGAGGCCACCACCGACTAA

Retrieve as FASTA