Entry information : SAspCcP
Entry ID 11128
Creation 2012-06-06 (Christophe Dunand)
Last sequence changes 2012-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-06 (Christophe Dunand)
Peroxidase information: SAspCcP
Name SAspCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP004]
Taxonomy Fungi/Metazoa; Choanoflagellida; Choanoflagellida; Choanoflagellida
Organism Salpingoeca sp. (Salpingoeca rosetta)    [TaxId: 946362 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SAspCcP
start..stop
S start..stop
MbrCcP 392 8e-139 63..322 1..266
CsubCcP01 352 8e-122 70..321 87..347
CspCcP06 339 2e-117 70..321 39..295
BemeCcP 336 2e-116 70..322 8..269
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 92432..92721 290 N° 2 91999..92144 146 N° 3 91640..91788 149 N° 4 91224..91354 131
N° 5 90768..91023 256  
complement(join(90768..91023,91224..91354,91640..91788,91999..92144,92432..92721 ))


exon

Literature and cross-references SAspCcP
DNA ref. GenBank:   GL832963.1 (92721..90768)
Protein sequence: SAspCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323
PWM (Da):   %s   35165.38  
PI (pH):   %s   5.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFVRGSQRLLRAGRMMSTAARASATATSRTARVATLALGVGAAGAAAFAATPAAAECSWWNPLSWFYGVDYNQLRADIEDIADDNMAGPLLVRLAWHCSGTYDKKTGTGGSNGATMRFAPESSDAANAGLDKARNLLEPLKAKYSVSYADLYTFAGVVAVESMGSPKVKWSPGRTDAADGKECPPNGRLPDATGASHLRDVFYRMGFNDREIVALAGAHTLGRCHIENSGFDGPWTRDPYGLDNDFFRLLIEEKWTIRPNFQPLQYEDSSKELMMLPTDMALVWDPSFKQYVELYAKDGDLFLKDFAEAFGKLLELGVPRN

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGTTCGTGGTAGCCAGCGCCTGCTGCGCGCAGGCCGCATGATGTCGACGGCTGCTCGTGCCTCTGCGACAGCCACGTCCCGCACTGCCCGTGTGGCCACGCTGGCCCTCGGTGTC
GGTGCTGCCGGCGCCGCCGCCTTCGCCGCCACCCCTGCCGCCGCGGAGTGCTCCTGGTGGAACCCGCTGTCGTGGTTCTATGGCGTCGACTACAACCAGCTCCGCGCCGACATTGAGGAC
ATTGCCGACGACAACATGGCTGGCCCTCTCCTCGTTCGCCTCGCCTGGCA
GTGCGTACACACACACACACACTCCTCGCGCTTTGTTTTGATTTGTTTGTTTTGTGTTTTCATTGTTTTG
AATTCGTGGTGGCTGTCATTGTCCATCGTGTGTTTGTGTATCTGTAGCGTGTCGTGTGTGTTTAGTGTTGTGGAGTGGAGTGGAGTGTTGTGGAGTGTGTCTGTTTGTGTGCACTGATGT
CGGTATCGTTGCGTCATACGCGATCGCACACGCACACGCACACACACACACACACACTCTCTCTCTCTCACGTGCGTTTGCGTCCTCTCCACTGTAGTTGCTCTGGCACGTACGACAAGA
AGACCGGCACTGGCGGCAGCAACGGCGCCACCATGCGCTTTGCCCCCGAGTCCTCCGATGCTGCCAACGCTGGCCTCGACAAGGCCCGCAACCTCCTCGAGCCCCTCAAGGCCAAGTACC
CCT
GTAAGTAGCTATGTGTGTGTATGCGTGTGTGTGTGTGTGCACAGTGTGATTGCTTGTTCTCTGCTCTCATGTTGTGTCGTCCATAACCTGCACTTTTATTCACTTCGCGCACGTATT
CTCTTGACACTGCTCCCACCAGCTAGCTCACTTTCCCCTGCTGTTTGTTTGCGCAAACCCTTGTGGTGTGCCTGCTTCATTTGTTGTGGTCAGCCGTCTCCTACGCCGATCTGTACACGT
TTGCTGGTGTTGTTGCTGTTGAGAGCATGGGCAGCCCCAAGGTCAAGTGGTCCCCTGGCCGCACGGACGCTGCTGACGGCAAGGAATGCCCTCCCAACGGCCGCCTCCCTGATGCCACCC
AA
GTGCGTGCATTTCGCTTGTTTGTATGTATGTGTGCGTGTGTGTGTGTGTGTGTGTGTTGTCTGTGTGCGTGTGCGTGTGTGTACGTGTTACCCGTGTGCGTACGTGTTGTCTGTGTGC
GTACGTGTTGTCCGTGTGCTTATCGGCCCCCTCCTGTCTGCTTGTAGCGTCTCGTGTCGCTTGCGTGCATGCATGCATTGTCACCCCCACCCCCCCCCCCCCCAACGCCGTATGACAACC
CACCTCGCGCATCCCACTCACCCTTTGTTCCCATCTCCGACGATTAGGGCGCGTCCCACCTGCGCGATGTGTTCTACCGCATGGGCTTCAACGACCGCGAGATTGTCGCCCTCGCCGGCG
CCCACACCCTCGGCCGCTGCCACATCGAGAACTCCGGCTTTGACGGCCCATGGACCCG
GTACAACCCCCTTCGGTGTATGTGTGTGGGTATGGGTGAAGCGGTGTAGCGGTGTAAGGTTG
CATGTTACATGAAGCAGTGGCCCAAAAGCGCCTTCTTCGTTGCCACGCACCTACGCATCCACTCGCCACTCATCACCTCCCCCCCCCCCCCTTTTTTTTTCTTCTCTTGCCGTACCTTCT
TTCTTGCTTGTTCTTCAGCGACCCATATGGCCTTGACAACGACTTCTTCCGCCTTCTGATTGAGGAGAAGTGGACGATCCGCCCCAACTTCCAGCCGCTGCAGTACGAGGACTCGAGCAA
GGAGCTTATGATGCTTCCCACGGACATGGCCCTCGTCTGGGACCCCTCCTTCAAGCAGTATGTGGAGCTCTACGCAAAGGACGGCGACCTCTTTCTCAAGGACTTTGCCGAGGCATTTGG
CAAGCTTCTCGAGCTCGGCGTGCCCCGCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGTTCGTGGTAGCCAGCGCCTGCTGCGCGCAGGCCGCATGATGTCGACGGCTGCTCGTGCCTCTGCGACAGCCACGTCCCGCACTGCCCGTGTGGCCACGCTGGCCCTCGGTGTC
GGTGCTGCCGGCGCCGCCGCCTTCGCCGCCACCCCTGCCGCCGCGGAGTGCTCCTGGTGGAACCCGCTGTCGTGGTTCTATGGCGTCGACTACAACCAGCTCCGCGCCGACATTGAGGAC
ATTGCCGACGACAACATGGCTGGCCCTCTCCTCGTTCGCCTCGCCTGGCA
TTGCTCTGGCACGTACGACAAGAAGACCGGCACTGGCGGCAGCAACGGCGCCACCATGCGCTTTGCCCCC
GAGTCCTCCGATGCTGCCAACGCTGGCCTCGACAAGGCCCGCAACCTCCTCGAGCCCCTCAAGGCCAAGTACCCCT
CCGTCTCCTACGCCGATCTGTACACGTTTGCTGGTGTTGTTGCT
GTTGAGAGCATGGGCAGCCCCAAGGTCAAGTGGTCCCCTGGCCGCACGGACGCTGCTGACGGCAAGGAATGCCCTCCCAACGGCCGCCTCCCTGATGCCACCCAA
GGCGCGTCCCACCTG
CGCGATGTGTTCTACCGCATGGGCTTCAACGACCGCGAGATTGTCGCCCTCGCCGGCGCCCACACCCTCGGCCGCTGCCACATCGAGAACTCCGGCTTTGACGGCCCATGGACCCG
CGAC
CCATATGGCCTTGACAACGACTTCTTCCGCCTTCTGATTGAGGAGAAGTGGACGATCCGCCCCAACTTCCAGCCGCTGCAGTACGAGGACTCGAGCAAGGAGCTTATGATGCTTCCCACG
GACATGGCCCTCGTCTGGGACCCCTCCTTCAAGCAGTATGTGGAGCTCTACGCAAAGGACGGCGACCTCTTTCTCAAGGACTTTGCCGAGGCATTTGGCAAGCTTCTCGAGCTCGGCGTG
CCCCGCAACTGA

Retrieve as FASTA