Entry information : MpuAPx01
Entry ID 11130
Creation 2012-06-06 (Christophe Dunand)
Last sequence changes 2012-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-02-03 (Christophe Dunand)
Peroxidase information: MpuAPx01
Name MpuAPx01
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Chlorophyta Prasinophyceae Micromonas
Organism Micromonas pusilla    [TaxId: 38833 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpuAPx01
start..stop
S start..stop
OtAPx01 367 2e-121 4..329 3..312
KmAPx01 320 3e-109 37..336 38..335
MbrAPx01 312 1e-106 29..329 4..281
OmarAPx01 310 2e-105 40..330 20..306
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..533 533 N° 2 731..1217 487  
join(1..533,731..1217)


exon

Literature and cross-references MpuAPx01
DNA ref. GenBank:   NW_003315891.1 (181824..180498)
mRNA ref. GenBank:   XM_003061593.1
Cluster/Prediction ref. JGI gene:   48214
Protein sequence: MpuAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339
PWM (Da):   %s   37108  
PI (pH):   %s   6.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDRANARVAATTAHITRAPTSAYMEDVVNQTPYRAALRACRDDLWKFIDETNANPIFVRLAWHDAGTFDYHVRSWPKCGGANGSIRFEEEMSHGANAGLSKALKYLEPFKAKHPLLSYADVIQLAGATAIEHAGGPKIKMRYGRVDVETPEECAREGNLPGAEPPFGDGSPDAATHLRNVFGRMGFSDREIVALSGAHTIGRAFKERSGVTENGYGAKNGTKFTGCPAGHGGGGGTCPFSARHDGDADKGVGMEGGRSWTKHWLKFDNSYFKREHDEDPANLLWMSTDKALHVDDEFRKVFEEYAESQEAFFADFAAAYKKLSECGARWKPVDGIVYEW

Retrieve as FASTA  
Remarks Complete sequence from genomic. strain="CCMP1545".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCGCGCGAACGCGCGCGTCGCGGCGACGACCGCGCACATCACGCGCGCGCCCACCTCCGCGTACATGGAGGACGTGGTCAACCAGACGCCCTACCGCGCGGCGCTCCGCGCGTGC
CGCGACGATCTGTGGAAGTTCATCGACGAGACGAACGCGAATCCGATCTTCGTGCGGCTCGCGTGGCACGACGCGGGGACGTTCGACTATCACGTCCGATCGTGGCCAAAGTGCGGCGGC
GCGAACGGAAGCATCCGCTTCGAGGAGGAGATGAGCCACGGCGCGAACGCGGGGTTATCGAAAGCGCTCAAGTACCTCGAGCCATTCAAGGCTAAACACCCGCTGCTGTCCTACGCGGAC
GTCATACAGCTGGCGGGCGCGACCGCGATCGAGCACGCGGGGGGACCGAAGATCAAGATGCGGTACGGCCGCGTCGACGTGGAGACTCCGGAGGAGTGCGCGAGGGAAGGGAACCTCCCG
GGCGCGGAGCCGCCGTTCGGAGACGGATCCCCCGACGCGGCGACGCACCTCAG
GCGCGTTCTATCTCACACTGGTCCCCATACGACCCCGTCGGCGTGGTGAACGCCGATCCTTAAGGAC
TTTTGCCGTCGTTTCTCTCCGCCCAGGGTCCCTCGCGTTCAATCCCGACACACCTCGACGCCTTTCAACTCCGCTTCTGACGCCTTTGAACTCCACCCCGACGTCGCTTTGTATGGACAA
TTACCCTCAGAAACGTCTTCGGACGCATGGGGTTCTCCGACCGCGAGATCGTCGCGCTCTCCGGCGCGCACACGATCGGCCGCGCGTTCAAGGAGCGCAGCGGCGTCACGGAGAACGGGT
ACGGCGCGAAGAACGGCACGAAGTTCACCGGCTGCCCCGCGGGGCACGGCGGCGGCGGAGGGACGTGCCCTTTCAGCGCGCGGCACGACGGCGACGCGGACAAGGGCGTCGGCATGGAGG
GCGGTCGGTCTTGGACGAAGCACTGGCTGAAGTTCGACAACTCGTACTTCAAGAGGGAGCACGACGAAGACCCGGCGAACTTGCTGTGGATGTCCACGGACAAGGCGTTGCACGTGGACG
ACGAGTTCAGGAAGGTGTTTGAAGAGTACGCGGAGTCGCAGGAGGCGTTCTTCGCGGATTTCGCGGCGGCGTACAAAAAACTGAGCGAGTGCGGCGCGCGGTGGAAGCCCGTGGACGGGA
TCGTGTACGAGTGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCGCGCGAACGCGCGCGTCGCGGCGACGACCGCGCACATCACGCGCGCGCCCACCTCCGCGTACATGGAGGACGTGGTCAACCAGACGCCCTACCGCGCGGCGCTCCGCGCGTGC
CGCGACGATCTGTGGAAGTTCATCGACGAGACGAACGCGAATCCGATCTTCGTGCGGCTCGCGTGGCACGACGCGGGGACGTTCGACTATCACGTCCGATCGTGGCCAAAGTGCGGCGGC
GCGAACGGAAGCATCCGCTTCGAGGAGGAGATGAGCCACGGCGCGAACGCGGGGTTATCGAAAGCGCTCAAGTACCTCGAGCCATTCAAGGCTAAACACCCGCTGCTGTCCTACGCGGAC
GTCATACAGCTGGCGGGCGCGACCGCGATCGAGCACGCGGGGGGACCGAAGATCAAGATGCGGTACGGCCGCGTCGACGTGGAGACTCCGGAGGAGTGCGCGAGGGAAGGGAACCTCCCG
GGCGCGGAGCCGCCGTTCGGAGACGGATCCCCCGACGCGGCGACGCACCTCAG
AAACGTCTTCGGACGCATGGGGTTCTCCGACCGCGAGATCGTCGCGCTCTCCGGCGCGCACACGATC
GGCCGCGCGTTCAAGGAGCGCAGCGGCGTCACGGAGAACGGGTACGGCGCGAAGAACGGCACGAAGTTCACCGGCTGCCCCGCGGGGCACGGCGGCGGCGGAGGGACGTGCCCTTTCAGC
GCGCGGCACGACGGCGACGCGGACAAGGGCGTCGGCATGGAGGGCGGTCGGTCTTGGACGAAGCACTGGCTGAAGTTCGACAACTCGTACTTCAAGAGGGAGCACGACGAAGACCCGGCG
AACTTGCTGTGGATGTCCACGGACAAGGCGTTGCACGTGGACGACGAGTTCAGGAAGGTGTTTGAAGAGTACGCGGAGTCGCAGGAGGCGTTCTTCGCGGATTTCGCGGCGGCGTACAAA
AAACTGAGCGAGTGCGGCGCGCGGTGGAAGCCCGTGGACGGGATCGTGTACGAGTGGTGA

Retrieve as FASTA