Entry information : OsPrx106-1 (Os07g44480 / OsPrx106-1)
Entry ID 1116
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx106-1 (Os07g44480 / OsPrx106-1)
Name (synonym) OsPrx106-1 (Os07g44480 / OsPrx106-1)
Class Class III peroxidase    [Orthogroup: Prx231]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx106-1
start..stop
S start..stop
OsPrx106-2 633 0 1..384 1..384
SbPrx44 391 3e-136 90..384 50..349
HvPrx19 387 4e-135 87..384 24..326
SiPrx143 387 1e-134 91..384 49..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26509301..26509708 408 N° 2 26508135..26508881 747  
complement(join(26508135..26508881,26509301..26509708))


exon

Literature and cross-references OsPrx106-1 (Os07g44480 / OsPrx106-1)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8GVG6
DNA ref. GenBank:   NC_008400.1 (26509708..26508138)
Protein sequence: OsPrx106-1 (Os07g44480 / OsPrx106-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (365)
PWM (Da):   %s   40154.24 (38257.1)  
PI (pH):   %s   7.22 (6.74) Peptide Signal:   %s   cut: 20 range:20-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLAVLLTLLALVGSVTCQGYTGNASPPTPITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSPPTTYLPPSPTPPSPAPASPSPPSLGLRVGYYSSSCPKAEQIVKDTVKNAVYTNRGIGAGLVRLFFHDCFVEGCDASVLLDPTTANSRPEKLGVPNFPSLRGFEVIDAAKAALESACPGVVSCADVVAFAGRDAAYFLSNANIDFAMPAGRYDGRVSLADETLTNLPSPFAGLDQLKKNFADKGLDADDMVTLSGAHSIGVSHCSSFSDRLASTTSDMDAALKANLTRACNRTGDPTVVQDLKTPDKLDNQYYRNVLSRDVLFTSDAALRSSETGFSVFLNVVIPGRWESKFAAAMVKMGGIGIKTSANGEIRKNCRLVN*

Retrieve as FASTA  
Remarks chromosome 7. No ESTs. TC248096
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGCTTGCTGTGTTGCTCACATTGCTGGCTCTGGTGGGCTCTGTGACATGCCAAGGCTATACCGGCAATGCTAGCCCACCCACACCCATTACATACCCAAGCCCGCCAAGCCTG
AGCCCGAGCACGCCGCCTACTTATCCTCCACCTAGCTCGACTCCTCCGAGCCTAGCACCGGTGAGCCCGAGCCCGCCGACAACCTATCTTCCACCAAGCCCAACTCCTCCGAGCCCGGCT
CCGGCAAGCCCAAGCCCGCCGTCCCTAGGGCTTAGAGTTGGTTATTACAGTTCCTCTTGCCCAAAAGCTGAGCAAATTGTGAAGGACACCGTCAAGAATGCTGTGTACACCAACCGCGGC
ATCGGCGCAGGGCTCGTCCGCCTCTTCTTTCATGACTGCTTCGTCGAG
GTAAAATCCTTTTTTATTAATTAAAACACGTGATTAATTAGTTAGTAAGGGATCACCTATACATTTATCGAT
AAATTTTCTTTTAAAAATTTGACAGATGTAATTATAGTATAATCGTGATGTAATTACACTGTAACTCGCATGTAACTTATATGTAACTTTCAAAAATATCTATGTAACATACTTTTTAGG
TAAAACGGAGGTCGTGGGAGCTAATCCTCTCAAATGTTTGCACACAGTGACTTTTTTCATTCTTCATTTGCATAAATCTTGAAACAATCTAACGGTTTAAAATTATGTGAAAGCTATATG
CAAGTTACATTATAGTTACAGTGTAATTACACTCCGATTGTGCTGCAATCGAGTTAGTAATCCACGTGATTAATGTGGCTGTGTATTGTCTCCTTTCGATTGATCAGGGCTGCGACGCCT
CCGTTCTGCTCGACCCGACGACGGCGAACTCGCGGCCGGAGAAGCTCGGCGTGCCCAACTTCCCCAGCCTCCGCGGCTTCGAGGTGATCGACGCGGCGAAGGCGGCGCTCGAGAGCGCGT
GCCCCGGCGTCGTCTCCTGCGCCGACGTCGTCGCCTTCGCCGGCCGCGACGCCGCCTACTTCCTCAGCAACGCCAACATCGACTTCGCCATGCCGGCCGGCCGCTACGACGGGCGCGTCT
CCCTCGCCGACGAGACCCTCACCAACCTGCCGTCGCCGTTCGCCGGGCTCGACCAGCTCAAGAAGAACTTCGCCGACAAGGGGCTCGACGCCGACGACATGGTCACCCTCTCCGGCGCGC
ACTCCATCGGCGTCTCCCACTGCTCCTCCTTCTCCGACCGCCTCGCCTCCACCACCTCCGACATGGACGCCGCGCTCAAGGCCAACCTGACGCGGGCGTGCAACCGCACCGGCGACCCCA
CGGTGGTGCAGGACCTCAAAACCCCCGACAAGCTGGACAACCAGTACTACCGGAACGTGCTCAGCCGCGACGTGCTCTTCACGTCGGACGCGGCGCTCCGGTCGTCGGAGACGGGGTTCA
GCGTGTTCCTGAACGTGGTCATCCCCGGCCGGTGGGAGAGCAAGTTCGCGGCGGCGATGGTGAAGATGGGCGGTATTGGAATCAAGACCAGCGCCAATGGCGAGATCAGGAAGAACTGCC
GCCTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGCTTGCTGTGTTGCTCACATTGCTGGCTCTGGTGGGCTCTGTGACATGCCAAGGCTATACCGGCAATGCTAGCCCACCCACACCCATTACATACCCAAGCCCGCCAAGCCTG
AGCCCGAGCACGCCGCCTACTTATCCTCCACCTAGCTCGACTCCTCCGAGCCTAGCACCGGTGAGCCCGAGCCCGCCGACAACCTATCTTCCACCAAGCCCAACTCCTCCGAGCCCGGCT
CCGGCAAGCCCAAGCCCGCCGTCCCTAGGGCTTAGAGTTGGTTATTACAGTTCCTCTTGCCCAAAAGCTGAGCAAATTGTGAAGGACACCGTCAAGAATGCTGTGTACACCAACCGCGGC
ATCGGCGCAGGGCTCGTCCGCCTCTTCTTTCATGACTGCTTCGTCGAG
GGCTGCGACGCCTCCGTTCTGCTCGACCCGACGACGGCGAACTCGCGGCCGGAGAAGCTCGGCGTGCCCAAC
TTCCCCAGCCTCCGCGGCTTCGAGGTGATCGACGCGGCGAAGGCGGCGCTCGAGAGCGCGTGCCCCGGCGTCGTCTCCTGCGCCGACGTCGTCGCCTTCGCCGGCCGCGACGCCGCCTAC
TTCCTCAGCAACGCCAACATCGACTTCGCCATGCCGGCCGGCCGCTACGACGGGCGCGTCTCCCTCGCCGACGAGACCCTCACCAACCTGCCGTCGCCGTTCGCCGGGCTCGACCAGCTC
AAGAAGAACTTCGCCGACAAGGGGCTCGACGCCGACGACATGGTCACCCTCTCCGGCGCGCACTCCATCGGCGTCTCCCACTGCTCCTCCTTCTCCGACCGCCTCGCCTCCACCACCTCC
GACATGGACGCCGCGCTCAAGGCCAACCTGACGCGGGCGTGCAACCGCACCGGCGACCCCACGGTGGTGCAGGACCTCAAAACCCCCGACAAGCTGGACAACCAGTACTACCGGAACGTG
CTCAGCCGCGACGTGCTCTTCACGTCGGACGCGGCGCTCCGGTCGTCGGAGACGGGGTTCAGCGTGTTCCTGAACGTGGTCATCCCCGGCCGGTGGGAGAGCAAGTTCGCGGCGGCGATG
GTGAAGATGGGCGGTATTGGAATCAAGACCAGCGCCAATGGCGAGATCAGGAAGAACTGCCGCCTCGTCAACTAG

Retrieve as FASTA