Entry information : EguGPx06
Entry ID 11166
Creation 2012-06-14 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EguGPx06
Name EguGPx06
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type Mesophyll cells
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguGPx06
start..stop
S start..stop
EgrGPx06 502 0 1..250 1..250
EglGPx06 404 4e-145 1..250 1..249
EgrGPx07 385 1e-137 1..250 1..244
EcamGPx06 371 8e-133 1..185 1..185
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2120..2413 294 N° 2 3158..3234 77 N° 3 3443..3504 62 N° 4 3676..3794 119
N° 5 3971..4138 168 N° 6 4230..4262 33  
join(2120..2413,3158..3234,3443..3504,3676..3794,3971..4138,4230..4262)


exon

Literature and cross-references EguGPx06
Literature Keller,G., Marchal,T., SanClemente,H., Ladouce,N., Wincker,P., Couloux,A., Teulieres,C. and Marque,C. Development and functional annotation of an 11,303-EST collectio from Eucalyptus for studies of cold tolerance. Tree Genet. Genomes 5, 317-327 (2009).
EST ref. GenBank:   CU400036.1
Protein sequence: EguGPx06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27235.02  
PI (pH):   %s   9.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCSSTKALLLRCRNLRAPLASSSPSSSALPFPIPFSPSVAQQTLLSPRPISSLPPPGPPIKPPPPFGCRSFVSRDRRSSRAMASQSSKGSIYDFTVKDARGNDVDLGSYKGKVLLIVNVASQCGLTNSNYTELSQVYEKYKNGLEILAFPCNQFGAQEPGTNEQIVEFACTRFKAEYPIFDVDVNGENADPVYKFLKSSKGGLFGDNIKWNFSKFLIDKEGNVVDRYAPTTSPLSIEKDIKKLLGVA*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
scaffold_5_14755 (2120..4262)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGCTCCTCTACAAAAGCTCTGCTCCTCCGCTGCAGAAATCTCCGCGCCCCTCTCGCCTCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTC
GCTCAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCCCGCCCGGCCCGCCGATCAAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGC
CGTGCCATGGCGAGTCAGTCCTCGAAAGGGTCGATTTACGACTTCACCGTCAAG
GTCGGTTCTCTCTCGAGGTTTCCCTTTTGTGATTTCGCGGGGGAACTGTGAATCGGGAGTCGCCCA
TCGGCAGAAATGTCGACCCATATAATAAAGTTCTCCTCCTTTTTTCTTTCAAGTCATTTCTGAGCGAAGATTTTGTTTTTTTATATCCACAGCGATGCTTCGATTTTATGTAACTCAGAA
AGATGAAATTTTTATTCAATTGGTGTCGAGACTTTCTTGTAATCTATGTAAAGCTGAGGCCTTTTTCCAAAGCCCCATATCAGAAATGTTAACCTCTATTATAAAGTTCGCTTTTCTTTT
TCTTTTTTTGGGTCATTTCTGAGCGAAGATTTTGTTTTTTTATATTCACAGCGACGCTTCGATTTTTTTAGCTCAGAAAGATGACATTTTTATTGACTTGGTGTTGGGACTTTCTTGTAA
TCTATGTAAAGCTGAGGCCTTCCAAAGTTCTTTCTGTAGCCTTGTTTTTGGAGGTTTTTGAAAGTTTAGGTGGTAATCTGAAAATGGACCAATCTACGGCACCTTTGATGTATAAGTTTC
CCTTTTATCTATGTAATTCGCTCAAATATCGGATTTTGTTGATTGAAATATCGAGTTTTGAGTAAGTTGTTGGGGTAAGTTGGTCAGGGAGCGAGATCATGTGTGTCGTGCCGTGTGCTG
AGAGGTTGTGAATCNTTTGAGGACCATGATGTTATGCTGTGCTGAGACTTGGAGATTCGGGTTCCTTTTTTTATTCAGGATGCTCGAGGAAATGATGTCGATCTCGGTTCCTACAAGGGC
AAGGTCTTGCTGATTGTCAACGTCGCTTCGCAGTG
GTAATTCTCAGGANTGTGTTTATGCCCCGTAACAGGGAACATCTGGTTGGACTTTAATCTTGGCCGATCTGGTTAAAAGCAATAT
CATATTTCATGCCTTTTATCATTTGGAATTCCTTATGCAATTCAGCTTGGGAGTAGCTCAGTGNTTTAGTAATCGGGTTGGTCCACCGTGTTCTAATTTTTTNTATCGGTATGTTTGTTG
CAGTGGACTGACCAATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCAAGGTCTCCTATGCCTCCCCTGATGTCCCATAGTATCTCGTGTTTTAGTGGAATCCTG
GCCTTAACAGGATAATAAAGATATATCGTATCAGAAAAAGCAGTTGGTTATTGGTATCACTTAGCATATGGAGATTCTAGAAAATTTAAAGAGGATGTCACTCTGATGTGATGCAGGGTT
GGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAGCCGGGGACAAATGAGCAGATCGTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCATTTTTGATAAG
GTAAA
AGATATACATGAGGTCCTTCTCTGAANATGAAGAGCATATGGTGAACTATCTCNCAAGAGTTTTTTGGAGTCGTATCTGCAGTTCCCTTATATTTCCTAGCAACTGGCAATTTGCAGTTT
GAATTTAAAAAAAAAAAGTGAGGATGAAGAATCTGATTGCTTTTTCTATAGGTTGATGTGAATGGTGAAAATGCTGATCCTGTTTACAAGTTCCTGAAATCAAGCAAGGGCGGACTCTTT
GGGGATAACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGTTGATCGCTATGCACCCACTACTTCTCCTCTTAGCATCGAG
GTGAGAGTCTGATCGTTGACG
ATCATGGTCGAAGTTTGTTGACTTTTTTTTTGGCTATTTGACTGAGGCATTGCGGCTGTTATTATCGCAGAAGGACATCAAGAAACTGTTGGGAGTGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGCTCCTCTACAAAAGCTCTGCTCCTCCGCTGCAGAAATCTCCGCGCCCCTCTCGCCTCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTC
GCTCAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCCCGCCCGGCCCGCCGATCAAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGC
CGTGCCATGGCGAGTCAGTCCTCGAAAGGGTCGATTTACGACTTCACCGTCAAG
GATGCTCGAGGAAATGATGTCGATCTCGGTTCCTACAAGGGCAAGGTCTTGCTGATTGTCAACGTC
GCTTCGCAGTG
TGGACTGACCAATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCAAGGGTTGGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAG
CCGGGGACAAATGAGCAGATCGTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCATTTTTGATAAG
GTTGATGTGAATGGTGAAAATGCTGATCCTGTTTACAAGTTCCTGAAA
TCAAGCAAGGGCGGACTCTTTGGGGATAACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGTTGATCGCTATGCACCCACTACTTCTCCTCTTAGCATCGAG
AAGGACATCAAGAAACTGTTGGGAGTGGCATGA

Retrieve as FASTA