Entry information : HaAPx-R (HanXRQChr13g0402951)
Entry ID 11167
Creation 2012-06-18 (Christophe Dunand)
Last sequence changes 2016-04-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaAPx-R (HanXRQChr13g0402951)
Name (synonym) HaAPx-R (HanXRQChr13g0402951)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAPx-R
start..stop
S start..stop
HarAPx-R 451 1e-162 98..325 1..228
VvAPx-R 415 8e-147 18..322 23..328
CclAPx-R 408 6e-144 18..322 28..333
CsAPx-R 407 2e-143 18..322 28..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 97456619..97456772 154 N° 2 97456188..97456305 118 N° 3 97452154..97452269 116 N° 4 97452004..97452074 71
N° 5 97451882..97451924 43 N° 6 97451244..97451340 97 N° 7 97451049..97451132 84 N° 8 97450296..97450417 122
N° 9 97450123..97450189 67 N° 10 97449824..97449929 106  
complement(join(97449824..97449929,97450123..97450189,97450296..97450417,9745104 9..97451132,97451244..97451340,97451882..97451924,97452004..97452074,97452154..9 7452269,97456188..97456305,97456619..97456772))


exon

Literature and cross-references HaAPx-R (HanXRQChr13g0402951)
DNA ref. HanXRQ genome:   HanXRQChr13 (97456772..97449824)
EST ref. Heliagene:   HaT13l026594
Cluster/Prediction ref. HanXRQ:   HanXRQChr13g0402951
Protein sequence: HaAPx-R (HanXRQChr13g0402951)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325
PWM (Da):   %s   35667.05  
PI (pH):   %s   7.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSITGFNFNLSFRHLYIQFPAQSRRKIEYGCTCTAVRPVLCSTSSSVSHSDENHVSTSYSRRLMTFMITFLLPLPKSIQLSGADAYAAADDLVLVQEEIRKVLSKSKAAGVLRLVFHDAGTYEMDDDGGMNGSISFELDRPENKGLKKSLILVEAKKMVDEKQPVSMADMIAVAGAEAVSLCGGPKIPVRLGRLDSMVPDPEGKLPEETLDASGLKQSFQRKGFSTQELVALSGAHTLGSKGFGNPVIFNNAYYKVLLEKPWLSAGMTSMVGLPSDRALVDDDECLRWISKYADDQDLFFEDFKNAYIKLVNSGAKWRRDS

Retrieve as FASTA  
Remarks Complete sequence from genomic and ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCATCACTGGCTTCAACTTCAACCTCTCGTTCCGGCATCTATACATACAATTTCCCGCTCAATCTCGCCGGAAAATCGAGTACGGCTGCACCTGCACCGCCGTTAGACCCGTC
CTTTGTTCCACGTCATCATCCGTTTCTCATTCAG
GTCAATTGTCATTATCTCAATCCAGTTACAACTTTGCCTACAGTTTCCCTAAATTGAAGATATAACGTATACGATTAGTGTTTTAT
TTGATTTCTGTTTGAAATTGTATCCATACTATTCTCAGTTGTGAAAAATAATTCATGAATTTTGGTTCATAACAACATGATGATGAACAGGACAACTGTTGGGGTTTAATATGGCAGTTG
GATAAACCCTAAACTTTTAAAACTTTAGATGAATGTTCATTTTAAGCTCTAGTTTTTTTTTTTTTTTTTTTTTTTTCTGAATTATAAAAGTTTTATATGTGATGCAGATGAGAATCATGT
TAGCACTTCATATAGCAGGAGATTGATGACTTTTATGATCACATTTCTTTTGCCTCTGCCTAAATCAATACAACTTTCTGGTGCCGATGCGTATGCTGCTGCAGA
GTAAGTGTATAACTA
GACTCGTGATGCAAATTGTTTATTCATAAGACCATGTGTTGTGGAAATGTCGTTTGGGCGCTTAGCCCCACTACATTGGCAAAGGAGGCTCGGAACACCGTATCAAGTGGAGCGCCAAGG
GGGCGTGGCGTGGGGGTGGAGTTGAATTTATTTTGATTATTTTTAAATAATAAATAATATGTTACCGAATCATATATAGCCACCTCAACCCATCACCACATATCACGACTCCACAACACA
TGTTCTTGGGTGTGAAGTGTGAAAGCGAAACGCTCCACTGCATACGTTTTTTCTTTAACAATCTATATATTAATATAGAAACCCGCTAGGGGCTGGACCCGTGCAACACATTTACAACCA
GTCGCTTACATCAAAATTCGACCAATTTTCCCAATCTAAGTTGCTTAATTTTGATCTATTATTTATCCAAAAGTACGAGTCTTCCTTTATGCCATCCACCACTTTTTGTACAAGGATCCA
CCTTTCGTTGAAGACCTTATCATTTCTGCTAAGCCAAATACTCCACTGACTTTTAAGGTAAACCATGTTGACCATCTACATCCAAGTTTTGAGCCCGGCTGTTTTTGACAGAAGTCATGT
CTCTCGGCATATCAATTCTCAGCCACGAACAGATATTCCACCAGACGCCTTGGGCTACAAGACACGACACAAACAGGTGATCAACGGACTCCTGCTCATCACCACCTTTGCATCTTTATC
CAAGGGTCTTTCCAAAACACAATATTTTTTCCATCTCCCAGCTTCACTTTCAGTTTCTCATTTAAAATAACTCCCATCTTGCCAAGAGAATCCTCCATACGACCTGGGGCCGTTTTTTAA
AGGGGACAATCGAATTACTTACATCTATTCGAGTAATGTATGACCCGAGCCCACAGTTGGTTAGGGTTGTCTTTAAATCACCACCACCATTTAGACATCATAGCTATGTTGTGTTCCTTA
AGGCCATCTAAAAACAACCCACTGTTCTTCCTTGGCTTAGCTAGCTTCTCCCATTTAATCCATCTCACTTTGTGTCTCGATCCTGATTTTCCCCATAGAAAGGACCTTCTTAGCAGGGAC
CTTGAAAACCAATAAGAAATATGATGGTAAACTGCCCAAAACCGTCTTCACGAGAGTGGCCCTACCCGTGAAGGATAGTGTCTTAGCGGACAACTTGTGGTTGAATTTGTCCACCTCCTT
ACTCGCTTCGGATTGATTAGACCCGATCGGGAGTCCGAAATACACGGACGTGAGAATGCCTGCTTTACAATGCATCACATTTGCCATTCTCTCCACGTCTTCCTCCTCCATCCTCTTATC
CAATCCTTCCACCTATCCGGAAAGCCCATGTACTTGGTTTAAAAAAGCGAGCTTTAAGCGAGCTTAAAGCGTGAGGTGATGAAGCGCTAGGGTTGTCGATTTTTTTGCTCTGAGGCGACA
AATCACATGAAGCGTTTTGAAGCGCGCTTTAAGCCCGAAGCGCCATTGGTTTGAAGCGACGCTTCAGCCCAATCAGGTCAGATTTGGTTTTTTATTTAGGCCCGATAGTCTCTAATAGGC
TTTAATTGAGGACCGCTATTTCTTTACCCTAAAAAAAGAACGTTAGTAAACATCTTCAGCCGCTCCCTCCCTCTTCTCCATCGATTCTTCATACTTTCTCCAATAATCGACTTTAATTTA
TGTTTTAACTATGTTTTTTATGTGTTAAGTATGTTTTTAATCATGTTTTTGTGTTTATTATTGATTAACAAGTAGAACTAGGATTTTGACCCGCCGCGCGTTGCGGCGGCGTCAAAAGTT
AAAGTAACTCGTATTTATACTTTATATTTAACCTGACTCTTTACTGAATAAAATTACGTCGCCGTCGAATGAAAATGTATTATATTTGACCCAACTCGTTTTCGAATCCAGTTTACGAAC
GTACATACAATAAGTATAAAACATATTATTTTTTAACAGACTTACTTGAGAAAAAAAGTTTATGTTAAAACGTGAATTTAAGATGACAGGTACGTTAAAACTGCGATACGCAACACATTA
CATTGGCGGCACCTTAGTTGTTTATAGCAGACGACACATTATGTGATGCGTTGACCATATATATAAAACACGTGTTTGATGTATCCGATCAAACTCAGTGTAACCTATATAAGCATTGTG
GTTACAATGTACAATGATGACAATAACGTGTGATGCCCGCACGTGACATTACACGTTTTTGACTTTGTTACACACGGTACTTTCGTGACATTAACGTCATTATGTATATATAAGGTATGG
CTCGATCCTTGTGGTGTAAAGTTGTAACAATATTTTAGACAATCGTGTAAAGTCGTAAAAGTAATCTAGTAATTAACATGTTTATACATAGATAAAAAATAGTATAATAATGTGTGGCAC
TATGGTATAAAGTCGTAAAAGCATTTCAAATAAAATGAGACGTCAAGTTATTAAGTAGAAAAAGTTGGCGGATCAAAGTTGTCAATTACCAAAAGTTAAAAGTGAATGTGTAACTTACTT
AGTTTGAAAGTGTGAAGTGAAAGAATTAAAAGTATAAGGGGTTAGAAAGTAAAAGTATTGGAGTTAGAATTCTAATATATGAAAATTGAAAGGAGATAAATGTTTAGAGGCTAAATGTGT
ATTTATGTAAAAGTTAAGAACTTAAAAGACAAAAATCCACGGACTTTGCCTTTTAAGATGTTATAAAATTTAGTTAACAAAATAGAGGTGTCAAAATGGAAAATGTCACACAGAAGGGGC
CAAAAAGAAAATGTGTTACAAAATATAAGGGGTCAAAAAGGAAATAACACTGATGAGCAAATAAGGCAGAATATTAAGGGGTGAAAGTGATTACTTTTCAAAATTTAGGGGTGTGTTTAG
GTCGGTGGTAAAAACCACCGACCTTTGTTTTTAAGAATATAGGTAATGTGTCATATTGATGTGTACAAAAAAAAAATTTGTTATTTTATTTTTTAATTTTGAGCGCTTCGTATATGTGAA
GCTCTCGCTTCGCGCTTGAAGCTTCGCTTAAAGCTTTTGGAACCAAAACGCTTCGGAGTGCCTCTGCGCTTTTTTAAACCAAGCCCATGTACTCATGCATCTTCAATAGAAATTTCCAAT
TCATCGTATCATATGCTTTTTCAAAGTCAACTTTGGAATCCATCACCTTCGTTTTACTCCTTTTGGCCCATGATACCGCTTAGGGGACCATTCAAGATGTTCCTCCCTCCACGAACGCTG
ATTGGGACTCAGATATGAAGGATTGGATAACTTTCTTGAGGCGATTGGAGAGGGATTTTGTAAAGCATACCAATCAACAAGATGGGTCTATAATCCGTCAATTCTTGGGGGTCTTCGACT
TTAGAAATGAAAGATGAGTTGCATCCTTCACCGATCACCCCTTTATCGAAGAAGTCTTTCATCAAGGACATCACACTAGGCTGAAACTTATCCCAAAAATGTCTCACCAGTTTAAAGGTG
AAACCATCCCGACCAGGAGCCTTCTTACCACCGCCCTTTTCACCTCCTCTTCCCAGATTAGCGGCCTGCTCTGCGGTGAAGTTCTTAAGGAGTTGAGACCCGTGTTCTGAAACTTTCGTC
TCCTCATTGGTTCGGCAAACTTCGACTTGAAGAATCTTTTCAGCCAGAATCGTGACCCACACACCATTAATAGGGACCCTATTTATTCTACTTCTAGCCGAACTAGACTTTATAATCCCA
TGAAAAAAGGAGCTGTTTTCATCCCCATATTTAGCCCAATTGACGCGTGTTCACATTCACCTGAACACAGCGTAAGGTTATAGTTGTTTCTTAACTAACTAGGGTTAAATAACACCCTCT
ATTTCATTCTAAAATGCAATGTTACACAAAACAAAGTTTAACAAGATTAATATTTGCTGTCAGTGATCTAGTCTTAGTACAGGAAGAGATAAGAAAAGTATTATCCAAGAGTAAAGCCGC
TGGTGTTCTTCGCTTGGTTTTTCATGACGCAGGAACCTACGAAATGGATGATGATTCGG
GTGTAATATTGTCATTAGTTAATTCAATTTCTTCAAGTCATGCCTTCATTGTAATTATATC
TTTCTACTGTTATTTCAGGTGGCATGAATGGCTCCATATCTTTTGAACTCGATAGACCCGAAAACAAAGGTCTTAAGAAATCATTGAAGGTTAATTCCCTTTCACTTGTTTACAAATTTT
GTTCATATGCATGTGTTCTTTTCACCTGAAACTAACTTTATTGTTTAGATTCTGGTGGAAGCTAAAAAGATGGTGGACGAGAAACAGCCAGGTTATGCTTCGTTTCATCATTACGTGTAG
TTTTTACTGTTAGTAGCATAATTTTAAGAGTAAAATGCCATTTTCGTCCCTGAGGTTTGCCCGGTTTTGCGACTTTCGTCCAAAGGTTTGTTTTCCCGCATCTGGATCCAAAAGGTTTGA
AATCTTGCCGTTTCATCCAGTTCGTTAACTCCATCCAATTTTTCTTCGTTAAGTCAGGGGTATTTCCATCTTTTTTGTTAACTTAAAGGGCAATTTGGTCTTTTTTGCTTTATGTACAAG
CATTTAGCATCATGTACAAGTATTCAGAATACCCTTACTGAATAAAAAACAAAAATAATATAGGTAAAAAGACGAAAATACCCCTGCTTAACGAAAAAAATGGATGGAGTTAACGTGTTG
GATGAAAATGGCAAGATTTCAAACCTATTGGTTCCAAATGCAGAAAAACAAACCTTTGGACGAAAGTCGCAAAACTGGCCAAACCTCAGGGACGAAAATGGCATTTTACTTTAATTTTTA
TATTTTTGTGATTTTTTGCCCTTCAATTACAGTGTCAATGGCTGATATGATTGCTGTGGCTGGAGCCGAAGCCGTCTCTTTATGCGGAGGTCCAAAAATCCCCGTTCGCTTAGGCAGATT
AGACTCGAT
GTAAGGGACTAATTTTTATCAAACGTTCTATAAAATAAGGTGAGATAGATACACTGTGATTGCTGTAACAAGAATCACATTATCGTTATAACGTTGTGTTTTTCCTTGTAG

GGTACCTGACCCCGAGGGAAAACTTCCGGAAGAAACGTTAGATGCCTCTGGATTAAAACAAAGTTTTCAACGAAAAGGTTTTTC
GTAAGTGAATACGAGAATATCTTGACCATGTTTGAC
TAAATCATTATATTCCTCTATTTTAGGCGAATTGGAAATAAATAGTCCCACCTAACTCAATTTGGCTGATAATAATCCCAATTCAGTTATTGGCCGATAATAATCCGAACTAGTCAATTT
TTTTTGTAAAATAGTCCGTCGTTAAAATAGCTTAACGGAGTTAAGTTTTTTTCCGAATTACAAACCGATGAATTAGGGCTTTTGATCAGAACGAGGATACGAGTCGATTGATATAAAACT
TACCTCGAAACTGTGCTCGAAATGGCTTGATTTTTGTTAATTGGAAGTTTAAACACCCGAATTGAAGCACCGTTTTCGTGGGTTGGGACAGTATTTCGAGATAAGTTTTACATCAATCGA
CTCGTATCCTCGTTCTGATCAAAAGCCCTAAAACATCGGTTTGCAATTCGGAAAAAAAACTTAACTCCGTTAAGCTATTTTAACGACGGACTATTTTACAAAAAAAAATTGACCAGTTCG
GATTATTATCGGTCAATAACTGACTTGGGATTATTATCGGCCAAATTGAGTTAGGTGAAATTATTTATTTCCAATTTGCCTCTATTTTAACAAAAAAATGGGATTTTGTTTGCAGAACAC
AAGAACTTGTAGCATTATCTGGTGCGCATACTCTTGGAAGCAAAGGTTTTGGAAATCCGGTTATTTTCAATAATGCGTATTACAAAGTCCTGTTGGAGAAGCCATGGCTATCTTCGG
GTT
TGTCACAAGCTTTTGGCTTGAAATTTGAAAACAATGTTACCGTTTTCTTGAGGCAAAAAACGTATTGCAGTGTTTATAATTTTTTCTATTTTTATGTGTTCAGCTGGAATGACAAGTATG
GTCGGTCTTCCTTCTGATCGTGCTCTAGTTGATGACGATGAATGCTTAAG
GTACAAACTACAATGTTATTCGGAATTGTAAATCATTTTATTTCGACCATCAAACCATGAAATCGGGCAA
ATCAAACGAGACTATCAGTGTTTAGTTGACTACCAACATTGGCTAGTCCTTTTGTGTTAAGAAAATGGTTAATAATTTCAAAGCGAACAAATCGAATCGCTTACACTTTTTTACTATTCT
CAGGTGGATCTCAAAGTATGCTGATGATCAAGATTTGTTCTTTGAAGATTTCAAGAATGCTTATATCAAACTTGTGAATTCTGGTGCAAAATGGAGAAGGGATTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCATCACTGGCTTCAACTTCAACCTCTCGTTCCGGCATCTATACATACAATTTCCCGCTCAATCTCGCCGGAAAATCGAGTACGGCTGCACCTGCACCGCCGTTAGACCCGTC
CTTTGTTCCACGTCATCATCCGTTTCTCATTCAG
ATGAGAATCATGTTAGCACTTCATATAGCAGGAGATTGATGACTTTTATGATCACATTTCTTTTGCCTCTGCCTAAATCAATACAA
CTTTCTGGTGCCGATGCGTATGCTGCTGCAGA
TGATCTAGTCTTAGTACAGGAAGAGATAAGAAAAGTATTATCCAAGAGTAAAGCCGCTGGTGTTCTTCGCTTGGTTTTTCATGACGCA
GGAACCTACGAAATGGATGATGATTCGG
GTGGCATGAATGGCTCCATATCTTTTGAACTCGATAGACCCGAAAACAAAGGTCTTAAGAAATCATTGAAGATTCTGGTGGAAGCTAAAAAG
ATGGTGGACGAGAAACAGCCAG
TGTCAATGGCTGATATGATTGCTGTGGCTGGAGCCGAAGCCGTCTCTTTATGCGGAGGTCCAAAAATCCCCGTTCGCTTAGGCAGATTAGACTCGATG
GTACCTGACCCCGAGGGAAAACTTCCGGAAGAAACGTTAGATGCCTCTGGATTAAAACAAAGTTTTCAACGAAAAGGTTTTTC
AACACAAGAACTTGTAGCATTATCTGGTGCGCATACT
CTTGGAAGCAAAGGTTTTGGAAATCCGGTTATTTTCAATAATGCGTATTACAAAGTCCTGTTGGAGAAGCCATGGCTATCTTCGG
CTGGAATGACAAGTATGGTCGGTCTTCCTTCTGAT
CGTGCTCTAGTTGATGACGATGAATGCTTAAG
GTGGATCTCAAAGTATGCTGATGATCAAGATTTGTTCTTTGAAGATTTCAAGAATGCTTATATCAAACTTGTGAATTCTGGTGCAAAA
TGGAGAAGGGATTCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGCGGGAA ATTGTATGAA AGATGTCGTC CATCACTGGC TTCAACTTCA ACCTCTCGTT CCGGCATCTA TACATACAAT TTCCCGCTCA ATCTCGCCGG AAAATCGAGT ACGGCTGCAC  CTGCACCGCC GTTAGACCCG TCCTTTGTTC CACGTCATCA TCCGTTTCTC ATTCAGATGA GAATCATGTT AGCACTTCAT ATAGCAGGAG ATTGATGACT TTTATGATCA CATTTCTTTT  GCCTCTGCCT AAATCAATAC AACTTTCTGG TGCCGATGCG TATGCTGCTG CAGATGATCT AGTCTTAGTA CAGGAAGAGA TAAGAAAAGT ATTATCCAAG AGTAAAGCCG CTGGTGTTCT  TCGCTTGGTT TTTCATGACG CAGGAACCTA CGAAATGGAT GATGATTCGG GTGGCATGAA TGGCTCCATA TCTTTTGAAC TCGATAGACC CGAAAACAAA GGTCTTAAGA AATCATTGAA  GATTCTGGTG GAAGCTAAAA AGATGGTGGA CGAGAAACAG CCAGTGTCAA TGGCTGATAT GATTGCTGTG GCTGGAGCCG AAGCCGTCTC TTTATGCGGA GGTCCAAAAA TCCCCGTTCG  CTTAGGCAGA TTAGACTCGA TGGTACCTGA CCCCGAGGGA AAACTTCCGG AAGAAACGTT AGATGCCTCT GGATTAAAAC AAAGTTTTCA ACGAAAAGGT TTTTCAACAC AAGAACTTGT  AGCATTATCT GGTGCGCATA CTCTTGGAAG CAAAGGTTTT GGAAATCCGG TTATTTTCAA TAATGCGTAT TACAAAGTCC TGTTGGAGAA GCCATGGCTA TCTTCGGCTG GAATGACAAG  TATGGTCGGT CTTCCTTCTG ATCGTGCTCT AGTTGATGAC GATGAATGCT TAAGGTGGAT CTCAAAGTAT GCTGATGATC AAGATTTGTT CTTTGAAGAT TTCAAGAATG CTTATATCAA  ACTTGTGAAT TCTGGTGCAA AATGGAGAAG GGATTCTTAG TTTTCCTGTT TTATATATTT TGTCAATACT GAGAGATGTT TTCAACAACT ATTTTAATCA GTATGAACCG GCTGGTTATA  CCGGTTAAAC CGGATATCGG ACACAAGTCC GGTACGATAA AGGCCGGTAA AATCTGAATA TGGTATGTCT TATGTACCGG CGGTAAATCC GGTTCTACCG TTCAAACCGT TGAACCGGTT 
TGCATTTTCT TAAGATTTGA TTTCTTAATT TTAATAAAAT ACGATGTTAA GGTAATACTG CCTTGCATTC CAATATGCAT CGCTGTTGGA ATTGTTACCC GC 

Retrieve as FASTA