Entry information : OsPrx107
Entry ID 1117
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx107
Name OsPrx107
Class Class III peroxidase    [Orthogroup: Prx110]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx107
start..stop
S start..stop
HvPrx19 483 7e-174 5..322 3..327
SiPrx143 467 6e-167 24..321 49..347
SiPrx119 464 1e-165 27..321 60..355
SbPrx15 444 2e-158 1..321 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26550104..26550310 207 N° 2 26550409..26551170 762  
join(26550104..26550310,26550409..26551170)


exon

Literature and cross-references OsPrx107
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8GVG0
DNA ref. GenBank:   NC_008400.1 (26550104..26551167)
Protein sequence: OsPrx107
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (300)
PWM (Da):   %s   34232.34 (32056.3)  
PI (pH):   %s   9.19 (9.32) Peptide Signal:   %s   cut: 23 range:23-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAARVAMWVACVLAMAAACQGRLRVGYYKRKCAPAEYVVRAVVGNAVRQNPGVGAGIVRMFFHDCFVQGCDASVLLDPTAANPQPEKLGPPNFPSLRGFEVIDAAKAAVEKACPGVVSCADIIAFAARDASFFLSGGGISYRIPAGRLDGRVSLANETLAFLPPPVFNLTQLVASFQAKGLDADDMVTLSGAHTIGRSHCSSFADRLSPPSDMDPGLAAALRSKCPASPNFTDDPTVAQDAVTPDRMDRQYYRNVLDRKVLFDSDAALLASRPTAAMVARNAAARGRWERRFARAMVKMGGIEVKTAANGEIRRMCRVVNE*

Retrieve as FASTA  
Remarks chromosome 7. 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCTAGGGTTGCGATGTGGGTGGCGTGCGTGTTGGCAATGGCGGCGGCGTGCCAGGGGCGGCTTAGGGTTGGGTACTACAAGCGGAAGTGCGCGCCGGCGGAGTACGTCGTC
AGGGCCGTCGTCGGCAACGCCGTCCGCCAGAACCCCGGCGTCGGCGCCGGCATCGTCCGCATGTTCTTCCACGACTGCTTCGTCCAG
GTACACAGATCGATCCGTACGTCCATGGCGATC
CATGGATACGCAACATTGGTTGCCGCAATTGATGACACTGAGTGACAAGTCGTTCGTGGTTGCAGGGGTGTGACGCGTCGGTGCTGCTCGACCCGACGGCGGCGAACCCGCAGCCGGAGA
AGCTCGGCCCACCGAACTTCCCCAGCCTGCGGGGGTTCGAGGTGATCGACGCGGCGAAGGCGGCGGTGGAGAAGGCCTGCCCGGGCGTCGTCTCCTGCGCCGACATCATCGCGTTCGCGG
CGCGCGACGCCTCCTTCTTCCTTAGCGGCGGCGGCATCAGCTACCGCATCCCCGCGGGGAGGCTCGACGGACGCGTCTCCCTCGCCAACGAGACGCTCGCGTTCCTCCCGCCGCCGGTGT
TCAACCTCACCCAGCTCGTCGCCAGCTTCCAGGCGAAGGGCCTCGACGCCGACGACATGGTCACCCTCTCCGGCGCGCACACCATCGGCCGCTCCCACTGCTCCTCCTTCGCCGACCGCC
TCTCGCCGCCGTCGGACATGGACCCCGGCCTCGCCGCCGCGCTCCGGAGCAAGTGCCCGGCGAGCCCCAACTTCACCGACGACCCGACGGTGGCGCAGGACGCGGTGACGCCGGACAGGA
TGGACAGGCAGTACTACCGGAACGTGCTCGACAGGAAGGTGCTGTTCGACTCCGACGCCGCGCTGCTGGCGTCGCGGCCGACGGCGGCGATGGTGGCGCGGAACGCGGCGGCGCGCGGGA
GGTGGGAGAGGAGGTTCGCGAGGGCGATGGTGAAGATGGGCGGGATCGAGGTCAAGACCGCCGCCAATGGCGAGATCAGGAGGATGTGCAGGGTTGTCAACGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCTAGGGTTGCGATGTGGGTGGCGTGCGTGTTGGCAATGGCGGCGGCGTGCCAGGGGCGGCTTAGGGTTGGGTACTACAAGCGGAAGTGCGCGCCGGCGGAGTACGTCGTC
AGGGCCGTCGTCGGCAACGCCGTCCGCCAGAACCCCGGCGTCGGCGCCGGCATCGTCCGCATGTTCTTCCACGACTGCTTCGTCCAG
GGGTGTGACGCGTCGGTGCTGCTCGACCCGACG
GCGGCGAACCCGCAGCCGGAGAAGCTCGGCCCACCGAACTTCCCCAGCCTGCGGGGGTTCGAGGTGATCGACGCGGCGAAGGCGGCGGTGGAGAAGGCCTGCCCGGGCGTCGTCTCCTGC
GCCGACATCATCGCGTTCGCGGCGCGCGACGCCTCCTTCTTCCTTAGCGGCGGCGGCATCAGCTACCGCATCCCCGCGGGGAGGCTCGACGGACGCGTCTCCCTCGCCAACGAGACGCTC
GCGTTCCTCCCGCCGCCGGTGTTCAACCTCACCCAGCTCGTCGCCAGCTTCCAGGCGAAGGGCCTCGACGCCGACGACATGGTCACCCTCTCCGGCGCGCACACCATCGGCCGCTCCCAC
TGCTCCTCCTTCGCCGACCGCCTCTCGCCGCCGTCGGACATGGACCCCGGCCTCGCCGCCGCGCTCCGGAGCAAGTGCCCGGCGAGCCCCAACTTCACCGACGACCCGACGGTGGCGCAG
GACGCGGTGACGCCGGACAGGATGGACAGGCAGTACTACCGGAACGTGCTCGACAGGAAGGTGCTGTTCGACTCCGACGCCGCGCTGCTGGCGTCGCGGCCGACGGCGGCGATGGTGGCG
CGGAACGCGGCGGCGCGCGGGAGGTGGGAGAGGAGGTTCGCGAGGGCGATGGTGAAGATGGGCGGGATCGAGGTCAAGACCGCCGCCAATGGCGAGATCAGGAGGATGTGCAGGGTTGTC
AACGAGTAA

Retrieve as FASTA