Entry information : CsubCcP01
Entry ID 11185
Creation 2012-07-04 (Christophe Dunand)
Last sequence changes 2012-07-04 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-10-18 (Marcel Zamocky)
Peroxidase information: CsubCcP01
Name CsubCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Trebouxiophyceae Coccomyxaceae Coccomyxa
Organism Coccomyxa subellipsoidea    [TaxId: 248742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsubCcP01
start..stop
S start..stop
MimpCcP01 409 2e-143 6..351 23..370
MconCcP01 409 2e-143 6..351 23..370
CsorCcP01 407 5e-143 68..350 57..338
CspCcP06 402 2e-141 52..347 1..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172534..172683 150 N° 2 172782..172877 96 N° 3 173086..173167 82 N° 4 173271..173330 60
N° 5 173433..173469 37 N° 6 173620..173765 146 N° 7 174140..174181 42 N° 8 174731..174828 98
N° 9 175311..175444 134 N° 10 175821..175971 151 N° 11 176314..176388 75  
join(172534..172683,172782..172877,173086..173167,173271..173330,173433..173469, 173620..173765,174140..174181,174731..174828,175311..175444,175821..175971,17631 4..176388)


exon

Literature and cross-references CsubCcP01
Protein ref. UniProtKB:   I0YTN9
DNA ref. GenBank:   AGSI01000011.1 (172534..176388)
Protein sequence: CsubCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356
PWM (Da):   %s   39155.66  
PI (pH):   %s   7.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFASLRLLSRRTLASQVSRIQSIAQAPVRQFSAEAAATKSGGWISGGGKWALLFGAAGLGGWYYAKENDFVGGVTGKAPSSAPTVPDYDKVRKAISDLMASDKAEEYDDGSFGPILVRLAWHCSGSYDKASNTGGSNGATMRFPPESGIGANKGLDVARKLLDPLKEQFPWISYSDLWTLAGAVAIEEMGPEIPWRPGRTDQPDGKNCPPDGRLPDASKGAQHIRDIFYRMGFNDQEIVALSGAHALGRCHRDRSGFEGPWTNSPITFSNEYFKLLLDEWNKKKWNGPLQYEDKTSKALMMLPTDMALVWDKKFKPYVELYAKDDEKFFQDFAKAFSTLLELGVPFKEELPNKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCGTCGCTACGGCTGCTGTCCAGGCGGACCCTGGCTTCACAGGTGTCCCGCATTCAGAGCATCGCTCAGGCTCCGGTACGTCAGTTTTCTGCTGAGGCAGCTGCTACAAAGAGC
GGAGGGTGGATAAGTGGAGGAGGAAAGTGG
GTGAGTAGCGTTGAAATTTTTTGTTATTACGCCAAAAATAGCCAAGATGCCCTGCTGGCTAGTACCTATGGGGATTCGTGTTGGTTGTGC
CTGTGCAGGCTTTGCTGTTCGGTGCAGCAGGCCTTGGAGGCTGGTATTACGCCAAGGAGAATGATTTTGTTGGTGGCGTGACTGGCAAGGCGCCGTCCTCAGCGGTGGGTTTGCCCAGAG
GACCTCATCTTCCATCTTGGAAACCCTTCCTTCTCACCTGCCCTGCCTTGAATTCACTTTGCCAAAGATCTTCGTCTTCGAGACGCAAATCACGATTGTATATAATTGTGGTATCGTTTC
TGGAACTGGTGCCAGCAATGGCTTGACGCTTGACCAAGGGACTGATCTTTGTGTCTGCTGCCTTCAACACAGCCAACTGTTCCCGATTATGACAAGGTCCGCAAGGCGATCTCGGATCTA
ATGGCGTCTGACAAGGCAGAGGAGTACGATGACG
GCGAGTTACTTCTTGTATCTTCACCTCCATTTTCAGATGAACAAAGATTGCATTGGCTGCAAGGAATATCAAGCCCTGAGTGACAC
CTGATGTGCAATGTCAGGCTCTTTCGGGCCTATCCTGGTCCGCCTGGCATGGCACTGCTCTGGGAGCTATGACAAAGGTGTGCCTCTGCCTCTTTGTCTCCTGTGACTCGTGGTTGGTAA
CCTGATGCCCTCCTAAATATGCTTCTAACTATATCTGACCAACTTTCCCTGCACTGCAGCTTCCAACACTGGAGGCAGCAATGGGGCCACAATGCGGTAGGTCTGCATCACCTTTGCGCT
TTTGCATGCATTAAAACTGCAGCAGCCCTCAACAAGCAGATGGGACATGCCGTTTTTCTGCTGCATATGTGCCTGAGATTTTGTTCTGCCATGTGCTAAGACTTCTGGTCCTACATGTCC
ATGCAGGTTCCCGCCCGAGAGCGGCATCGGTGCCAACAAAGGACTGGACGTTGCGCGCAAGCTGCTGGACCCTCTGAAGGAGCAGTTCCCCTGGATCTCCTACTCTGACCTGTGGACCCT
GGCAGGCGCTGTCGCCATCGAGGAGATGGGAG
GTGCGCACACACATGCATCCTTCTTCATAATGTTATCCCAGCATCTGGACTTGAAGTTGATTTTGTGAGAGGGATGCAGACAGCAAGG
CAGTGCGGGCGCACATGCGTGTTCTTCCATCACCTGCTCTAGACTTCTAGCACCAGTGAGAAGCGCCCTCTCAAATGTTGGCCTCGAGAAGATATAAATCTGCAGTAATTTGAAGAGGAA
TGCGGACAGCGAGGCAGAGTGAGCGCCAGAGACAAGAGGAAGGGCTGCCTCAAAAGCGGATATGCTGCCGTAAATGATGCATGCAAGATGCATGCGTGCATGCTGATGGTATCACAGATT
TGAAGAATGTGGGCTGTATCTCTGAAGGATGTATTGTGCTCCTCAGGCCCCGAAATCCCATGGAGGCCAGGCCGCACCGACCAGCCAGGTGCCTTGCCCCTACCCTCCCATGCTGAGACA
TCTTGCTCTGACCAAAAGAGTGACATGCATCTTTAAATCTGCATATCTGATGCTGCAGCATTCCCTTGTCATGAAGCTGTGTGGGTGCCAGTGAAGCCCTCTGCGCATGCTGCAGTGCAG
ATGCAGGCTGCACGCCAGCCAGGGATCTGAGAGATGGGTGCTGCAGACAGAATAACAGTCACACAGTCCTGTCAGTGACACTTACATCAACTGCATACAATGCCATCATCTGCAAGCAAC
ACACGTGAGAGTTTCTGTGTGTATGCTTTTTGGCCATTCATCTTTGGGTTTGCCGACCTGTGATAACACTGGCTCCGGCTGGCGGGAGGCGGTCCAAATACTGAGCACCGTGCCCACGGT
CAAAAGGGTCTTGCTTGGATCTGGCGAGTCCGTCAAGGGTAAAATTTTGTTACCCTTCACATGCAGCTTGTCTGCAGACTCACCTTGCCTCTGGCAGGGAAAGCGTGTAACATTAGTAAT
TTTGATAGCACTAGTGAGAGAGTGGGCTGGTGTGCAGACGGCAAGAACTGCCCCCCGGACGGTCGCCTGCCGGACGCATCTAAGGGCGCTCAGCACATACGAGACATCTTCTACCGGATG
GGCTTCAACGACCAG
GTATGCACTCTGCACCCCTCGCCCATTACACTATCTTGGTGCCAGGAAGGAGAGGCTCGGCTCCACCATTCCTGCATGCACTGTGCTATCATGCAGTGGTGCAAT
GAACATACCATGCAGCCATGGGAGGCTACTAGAGGAACACATGTAAGCATTCCAGGACCCTGCTGGCCCTGGCTAATAGGAGAGGAAATTTCATATGTGACCAAAGGGCACGTATGCATG
AGCTTTATGCATGCCGAGGCCCCCCAGAGCCCTCCCTGGAAATGTGACATGATATTGTCACATGATAGACTGCTTGTCGTGGTTTTATTTCTGTGCCATGATGCAAAGCAGGCCCCTGCT
GAACCTGCTTGAACACAGGACGATGTCGTGTGTGACCCAGTCGGCATGCATGCATGCATGCCAGGCCCCCTGCCATACCTCAAGTAGGCTGGGGCATTAAAATACCTAAATTGGCATTCT
TGGTGCCTCCAAAACAGGAGATAGTTGCGCTGAGCGGCGCGCATGCGTTGGGGCGCTGCCACCGCGACCGCAGCGGCTTTGAGGGCCCCTGGACCAACTCGCCCATCACCTTCTCCAACG
AGTACTTCAAGCTGCTGCTCGACGAGAAATG
GTGCGCCGGCATGCTCCCTCCCTTTTCATTTTTCAATTATCTGGTCCCAGTATTCACATGACCTCTCGGTGGGGTTACCTGTTCCTGTT
GCTATGCATGCTGTCTGTGCAAAGTGCGCATTGGGTGTTTTGGATAGACTAAAATGGCTATCAGCGGATCTGGCAATACCTGTGTTGGCTATTGCGGGGTTCCATTATGGCTCGCCAAGA
CTCCTTGACATGTGTCCGTGTGGAGATGTTTCCTGTCCAATCCTTGACTTCATGATTCAATTTCGCATATTTCCATGAACTTGCTGACAGTGCACTGCAATGCATGCATCAAGGCATGCT
CGACGCAAATACGACCGATGGTGAGATTGCCGGTGATATACGTGCAGGAACAAGAAGAAGTGGAACGGGCCGCTGCAGTATGAGGACAAGACGAGCAAGGCGCTCATGATGCTGCCCACT
GACATGGCACTTGTCTGGGACAAGAAGTTCAAGCCCTATGTCGAACTGTACGCCAAGGACGACGAAAAGTTCTTCCAG
GTGTGCACTTTCCCTTTCCGTGCCTGCTATGAAGACACCTTC
AGTGTCGCTGACTACATGACTTGATTGACTGAAAGCTTCTTCTGCCCTGAGCATCATATTACATGATGCCAGGGGATTATTGGCACGTGTTGCTGTGATCACCTGCAACTCTCATTCTCA
ATTTGATAGTGTGGGATCTTTACTCCGTTTGCTCTACTGTGCCTCACAGCCCTTTCATATCACTTGGCAGTCCCGCTTTTCAGTGTCTGCGCTGCTTCTCGCGCTCTTGTGCTTGCCTCC
TGCTTGACACAACAAAGGTGTTCAAATGTTGTAATGACACACATTGCTGACTGGACGCAGGACTTTGCCAAGGCGTTCTCCACTCTGCTGGAGCTGGGAGTCCCTTTCAAGGAGGAGCTG
CCCAACAAGGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCGTCGCTACGGCTGCTGTCCAGGCGGACCCTGGCTTCACAGGTGTCCCGCATTCAGAGCATCGCTCAGGCTCCGGTACGTCAGTTTTCTGCTGAGGCAGCTGCTACAAAGAGC
GGAGGGTGGATAAGTGGAGGAGGAAAGTGG
GCTTTGCTGTTCGGTGCAGCAGGCCTTGGAGGCTGGTATTACGCCAAGGAGAATGATTTTGTTGGTGGCGTGACTGGCAAGGCGCCGTCC
TCAGCG
CCAACTGTTCCCGATTATGACAAGGTCCGCAAGGCGATCTCGGATCTAATGGCGTCTGACAAGGCAGAGGAGTACGATGACGGCTCTTTCGGGCCTATCCTGGTCCGCCTGGCA
TGGCACTGCTCTGGGAGCTATGACAAAG
CTTCCAACACTGGAGGCAGCAATGGGGCCACAATGCGGTTCCCGCCCGAGAGCGGCATCGGTGCCAACAAAGGACTGGACGTTGCGCGCAAG
CTGCTGGACCCTCTGAAGGAGCAGTTCCCCTGGATCTCCTACTCTGACCTGTGGACCCTGGCAGGCGCTGTCGCCATCGAGGAGATGGGAG
GCCCCGAAATCCCATGGAGGCCAGGCCGC
ACCGACCAGCCAG
ACGGCAAGAACTGCCCCCCGGACGGTCGCCTGCCGGACGCATCTAAGGGCGCTCAGCACATACGAGACATCTTCTACCGGATGGGCTTCAACGACCAGGAGATAGTT
GCGCTGAGCGGCGCGCATGCGTTGGGGCGCTGCCACCGCGACCGCAGCGGCTTTGAGGGCCCCTGGACCAACTCGCCCATCACCTTCTCCAACGAGTACTTCAAGCTGCTGCTCGACGAG
AAATG
GAACAAGAAGAAGTGGAACGGGCCGCTGCAGTATGAGGACAAGACGAGCAAGGCGCTCATGATGCTGCCCACTGACATGGCACTTGTCTGGGACAAGAAGTTCAAGCCCTATGTC
GAACTGTACGCCAAGGACGACGAAAAGTTCTTCCAG
GACTTTGCCAAGGCGTTCTCCACTCTGCTGGAGCTGGGAGTCCCTTTCAAGGAGGAGCTGCCCAACAAGGCCTAA

Retrieve as FASTA