Entry information : EguPrx97
Entry ID 11187
Creation 2012-07-10 (Qiang Li)
Last sequence changes 2016-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-11 (Achraf Jemmat)
Peroxidase information: EguPrx97
Name EguPrx97
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx97
start..stop
S start..stop
EglPrx97 681 0 1..350 1..350
EcamPrx97 679 0 1..350 1..350
EgrPrx97 679 0 1..350 1..350
EcamPrx96 631 0 1..350 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4119..4352 234 N° 2 3177..3371 195 N° 3 1220..1843 624  
complement(join(1220..1843,3177..3371,4119..4352))


exon

Literature and cross-references EguPrx97
Literature Identification of 8050 cDNAs from a normalized Eucalyptus xylem full-length RT cDNA library, Sivadon,P., Ladouce,N., Wincker,P., Couloux,A., San Clemente,H. and Grima-Pettenati,J. Unpublished (2006).
EST ref. GenBank:   CT981427.1   CU396284.1   CU397236.1   CU397746.1
Protein sequence: EguPrx97
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   37753.95 (35033.5)  
PI (pH):   %s   4.79 (4.66) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MXSRFSSFVLISCLVIASSPVHVSSSAHLVKGLSWSFYEKSCPKVESVIRKHLKKVFEEDIGQAAGLLRVHFHDCFVKGCDGSVLLDGSAXEPSEXDAPPNRXLRRTAFKXIDDLSQLVEKKCGQVVSCADXAAIAARDSVFLSGGPEYDVPLGRRDGLTPATENVVXENIPAPTEXASEILSALAKKXFDXTDVVALSGGHTIGLAHCTAFENRLYPTQDPTMEKTFAHDLKGVCPTTNSTNTTVLDIRSPNRFDNKYFVDLVNRQGLFTSDQDLYEDPTTRDIVTSFAEDQELFFEKFVLAMTKMGQLSVLTGTKGEIRANCSVRNSENPDLLKXVVEEDLESYAELK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 3 ESTs.
scaffold_6_22373 (4352..1220)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGNCTCCCGTTTCAGCTCTTTCGTTTTGATTTCTTGTCTNGTGATAGCTTCATCGCCTGTTCATGTCTCGAGCTCTGCTCACTTAGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAA
AGCTGTCCCAAGGTTGAGTCCGTCATCAGGAAACATCTCAAGAAGGTGTTTGAGGAGGACATTGGCCAAGCTGCCGGGCTACTTCGTGTGCACTTCCATGACTGCTTTGTTAAG
GTAGGT
ACCCAAGGAGCTCTGTCACAATCTGCATTCACTATACCGGNCAAAGTNATTTGGGATTTACTTGAAAGTTGTATCTTGATTTGCTCGTCACATGTCCTTATATATGGTGGTCAGCTGATG
TTAAAATGTTTACNCACCCTTTTGGCAAGATCTGNGATCATCTTCTTCCCCAGCAAAATAGACGAGAATAAGAAAAGACACACAGGCCAAAGAAAAAAAAAAGTTCTTGTCGAGTTGGTG
GCCTAGGTTAGCAGCTGCAATAAGTGAACTTCTTTCCTTTTGATATTGCTAATTTTTAGAATGCTGGGTAGCTTACGAAGTCATACGGGCGCCTAAAGCCATCANGACTTTGTCTTTTAG
CATACTAATCTTACTGTCTTACTAGTAAACACTTGCTGAAGTTTTGGAGGATGCTTTTTGAGCGTTTGACATAGTTGATCCTGATCNTTAGTGCTTTATATGCTAAAATGAAGAGCATAG
AAGTTCATAGAACTCCCATGTTCAGGTTTTAGACAGAACTGCTGTAATAATTCTGGTAAATTGTCTTNATAAGATGATTGTACGAGCAGTCCAGTTAAGCCCGGATTGTGTGTGGCGAGG
ATTTTTTTGCTTTGAAGGTTAGGATGGGTTTAAGTCATCACGGTTTCTTTTACAATTGAATCTTGATCACTTACATTAAAATAAATGATAAAACATTCTTTGAATTCACGATTATTTTTT
AAGATCTGATGAGTGATGCAGGGATGCGATGGTTCGGTGTTGCTGGATGGATCAGCAANTGAACCAAGTGAGCANGACGCTCCACCAAACAGGAGNTTGAGACGGACAGCATTCAAGATN
ATTGATGACCTCAGTCAGCTCGTGGAGAAGAAATGTGGTCAAGTAGTCTCTTGTGCCGACATNGCNGCCATTGCCGCTCGTGATTCCGTTTTCCTG
GTAAACCCCCTTCAGCCATCATTC
CATCATCACTAGAGAGTAACNCACCAAAACAGAGTTCTGATTATGATACTCGCNAGATTCTGATTATCATACTATCGGAAATTTGATAGAAGTACAGATTCTTGCCGAACATGCTTATCC
CTATAAATCATACTAATTTGCAGCTTTGAATGACGCTTTTGCATTTGGTAATGGGAAGGCAAATATGATCATAAGCTTTCAAAATAGAGCAACAGCAGAATACAGTATTGGTCAGTTAGC
TAGCTTCCTAGATAATTGTAATAGTTCTTATGTTCAAGTTGATAAATGGATTTCTTTTTAGGGATTAATTGGATTATCGAACTAACCAAACATATAGTAAGTTACACGTTCACACAGAAN
TTTCACTGATTGGATGTTCCCCCTCNGTTAAACATTCAACCACTCCCCATTAATCTGCTGTTTTTGGAAATCAAGTTGATGTATAAAATACCCCAAACCTAACAGAATGTNGACCTTCGC
AANATGGTACTGGAACTTTGATCTCGTCATGTGGCCNTGTGACAGACAATAGTTGTTTAACCACTCTTGTTTAGGCTCAGGCTTGATTATACTCATTAGTTATGATGATAATTATACTTT
ATCGCNCTCTCAATGGTAATGTTCGATGATGCTTGGTAAGAGGAATTATAAATCACGAGAAAGTGGACTCGCTGATGTAACCAAGCGTGGTTAAACTATATTTNGATTCTTGTAGTTTCC
TCCTGTTCGTGTTCTGAATGNTTTGTGAGATGTAGCNGATGTCCATNTAAGTCGGCAGCATTATCTTGGAAACTCAGGACAATTAAACCTGTCATTATGAGCCAAAAAGTTCAGTATACA
GCAAATTTCAANGGTCAAAACTGAGACATCGTCGTTGTTTATATCTGAGTTTTAACGGGTAGTNATCACCATTTTTTTAAGATCCCAACCAGTCGGAGGTTTATTCTGAATTTTGGGATC
ATGTTTATGGATAAAATACTGCAACTTGACANGTCTTTGGACTCTTTCAACATGGTCAGGTAAGCATGTGCTTCCAAAGTTCTTGGAAATNGCAGTTGAAATGACAACCTAGGTAGACGA
TTCTGTTTAATGATAATCTACTCCCAACTAGCTTCTAGTTTATGAGAGTTGACTTGCAAATGATCACCTCCACACGAAGAAGACATCAAAGTTCTCCGCTGGCTTCATGTCCTATACATG
ATCGAAGTTTTCTCGATTATGATTACTATTGCCCATCATATCAATGAGCATCAACAGATGTTTTCCAAGTTCTGGATTCTAATTCTGTTATTCTCGTCGTCGTGTGCAGTCGGGCGGACC
TGAGTATGATGTGCCGTTGGGNAGGCGGGATGGACTTACGCCTGCGACTGAAAATGTGGTCNNAGAGAATATACCTGCACCAACTGAGAANGCCAGTGAAATTCTCTCCGCCCTAGCCAA
GAAAANCTTCGACNCTACCGACGTAGTGGCCCTCTCTGGAGGCCACACCATTGGGCTTGCGCACTGCACCGCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACCATGGAGAAGAC
CTTTGCCCATGATCTCAAGGGCGTGTGCCCCACCACAAACTCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTCGATTTGGTGAACCGCCA
AGGCCTGTTCACCTCAGACCAAGATCTGTATGAGGATCCCACAACGAGGGACATCGTCACTAGCTTCGCCGAGGACCAGGAATTGTTCTTCGAGAAGTTTGTCCTAGCNATGACGAAGAT
GGGACAACTCAGTGTGTTGACAGGGACGAAAGGAGAAATCCGAGCCAACTGCTCGGTCAGGAATTCTGAGAACCCCGATCTCTTGAAGTNCGTGGTGGAAGAGGACCTGGAGAGCTATGC
TGAATTGAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGNCTCCCGTTTCAGCTCTTTCGTTTTGATTTCTTGTCTNGTGATAGCTTCATCGCCTGTTCATGTCTCGAGCTCTGCTCACTTAGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAA
AGCTGTCCCAAGGTTGAGTCCGTCATCAGGAAACATCTCAAGAAGGTGTTTGAGGAGGACATTGGCCAAGCTGCCGGGCTACTTCGTGTGCACTTCCATGACTGCTTTGTTAAG
GGATGC
GATGGTTCGGTGTTGCTGGATGGATCAGCAANTGAACCAAGTGAGCANGACGCTCCACCAAACAGGAGNTTGAGACGGACAGCATTCAAGATNATTGATGACCTCAGTCAGCTCGTGGAG
AAGAAATGTGGTCAAGTAGTCTCTTGTGCCGACATNGCNGCCATTGCCGCTCGTGATTCCGTTTTCCTG
TCGGGCGGACCTGAGTATGATGTGCCGTTGGGNAGGCGGGATGGACTTACG
CCTGCGACTGAAAATGTGGTCNNAGAGAATATACCTGCACCAACTGAGAANGCCAGTGAAATTCTCTCCGCCCTAGCCAAGAAAANCTTCGACNCTACCGACGTAGTGGCCCTCTCTGGA
GGCCACACCATTGGGCTTGCGCACTGCACCGCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACCATGGAGAAGACCTTTGCCCATGATCTCAAGGGCGTGTGCCCCACCACAAAC
TCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTCGATTTGGTGAACCGCCAAGGCCTGTTCACCTCAGACCAAGATCTGTATGAGGATCCC
ACAACGAGGGACATCGTCACTAGCTTCGCCGAGGACCAGGAATTGTTCTTCGAGAAGTTTGTCCTAGCNATGACGAAGATGGGACAACTCAGTGTGTTGACAGGGACGAAAGGAGAAATC
CGAGCCAACTGCTCGGTCAGGAATTCTGAGAACCCCGATCTCTTGAAGTNCGTGGTGGAAGAGGACCTGGAGAGCTATGCTGAATTGAAATGA

Retrieve as FASTA