Entry information : OsPrx109
Entry ID 1119
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx109
Name OsPrx109
Class Class III peroxidase    [Orthogroup: Prx084]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx109
start..stop
S start..stop
SiPrx122 509 0 1..318 22..338
TaPrx114-1A 498 4e-180 20..318 21..319
AvePrx114-1A 498 4e-180 20..318 21..319
SbPrx45 484 3e-174 18..318 17..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28606656..28606862 207 N° 2 28607161..28607352 192 N° 3 28607431..28607988 558  
join(28606656..28606862,28607161..28607352,28607431..28607988)


exon

Literature and cross-references OsPrx109
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1I4
DNA ref. GenBank:   NC_008400.1 (28606656..28607985)
Protein sequence: OsPrx109
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (297)
PWM (Da):   %s   33022.67 (31020.6)  
PI (pH):   %s   8.26 (8.40) Peptide Signal:   %s   cut: 22 range:22-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASCLSVLLLLCLALAGSVSGQQLSATFYSRSCPRALAIIRAGVRAAVAQEPRMGASLLRLHFHDCFVQGCDASVLLNDTANFTGEQGANPNVGSIRGFNVVDNIKAQVEAACKQTVSCADILAVAARDSVVALGGPSWRVLLGRRDSTTASLALANSDLPPPSFDVANLTASFAAKGLSQADMVALSGAHTVGQAQCQNFRDRLYNETNIDAAFAAALKASCPRPTGSGDGNLAPLDTTTPTAFDNAYYTNLLSNKGLLHSDQVLFNGGAVDGQVRSYASGPSRFRRDFAAAMVKMGNIAPLTGTQGQIRLVCSKVN*

Retrieve as FASTA  
Remarks chromosome 7. 11 ESTs. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTGTCTGTCAGTCCTGTTGCTCTTGTGTCTAGCACTTGCAGGTTCAGTCTCCGGGCAACAACTGTCGGCTACATTCTATTCGAGGTCGTGCCCGAGAGCTCTGGCCATCATC
AGGGCCGGCGTGAGAGCTGCGGTGGCGCAGGAGCCTCGCATGGGGGCGTCACTGCTCAGGCTTCACTTCCATGACTGCTTTGTCCAA
GCAAGTCGTGCATTTCCACACTACTTGACTTAC
ATTTTTATATCCATCAGTCAATTACATTGTGGTCGCAGCCTTTGCAGTTTCAGTTCTTTACACTCTTTCAGTCTCTCTTCCAGTTTAATGTGCTGCGTCAGAACAGAATGGACTCGTAGC
ACTGTGTTGACGTTGGATTAGAGAGACTATGGCCACCGAATTTGCTCTCAAGTCATACTAGTTCCTACTACTACTCTGAATTAACCTGAAAAAATTAACTCAACGTGCTAATTGTGTGTT
GTGCATCGTGGGTGACATGGATCAGGGGTGCGACGCGTCCGTACTGCTGAACGACACGGCCAACTTCACCGGCGAGCAGGGGGCGAACCCCAACGTCGGATCCATCAGAGGATTCAACGT
CGTCGACAACATCAAGGCGCAGGTCGAGGCCGCGTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCC
GTAAGATCATGCCCATCCTTGAG
CGCGCAGCTATACGTACTATACGGCGAGCGGCGAACTGAACTTGTGTGTGTGCAGTTGGGTGGGCCGTCATGGAGGGTTCTTCTCGGGAGGCGTGACTCGACGACGGCGAGCTTGGCGCT
GGCGAACAGCGACCTGCCACCTCCGTCCTTCGACGTCGCCAACCTCACCGCCTCGTTCGCCGCCAAGGGGCTGAGCCAAGCCGACATGGTGGCGCTCTCCGGCGCGCACACGGTCGGGCA
GGCGCAGTGCCAAAACTTCCGCGACAGGCTCTACAACGAGACCAACATCGACGCCGCCTTCGCGGCGGCGCTCAAGGCCAGCTGCCCGCGGCCGACGGGCAGCGGCGACGGCAACCTGGC
GCCGCTGGACACGACGACGCCCACCGCGTTCGACAACGCCTACTACACCAACCTGCTGTCGAACAAGGGGCTCCTGCACTCCGACCAGGTGCTCTTCAACGGCGGCGCCGTCGACGGCCA
GGTCCGGTCGTACGCGTCCGGGCCGTCGAGGTTCAGAAGGGACTTCGCGGCGGCCATGGTGAAGATGGGGAACATCGCCCCGTTGACGGGAACGCAGGGACAAATCAGGCTCGTCTGCTC
CAAGGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTGTCTGTCAGTCCTGTTGCTCTTGTGTCTAGCACTTGCAGGTTCAGTCTCCGGGCAACAACTGTCGGCTACATTCTATTCGAGGTCGTGCCCGAGAGCTCTGGCCATCATC
AGGGCCGGCGTGAGAGCTGCGGTGGCGCAGGAGCCTCGCATGGGGGCGTCACTGCTCAGGCTTCACTTCCATGACTGCTTTGTCCAA
GGGTGCGACGCGTCCGTACTGCTGAACGACACG
GCCAACTTCACCGGCGAGCAGGGGGCGAACCCCAACGTCGGATCCATCAGAGGATTCAACGTCGTCGACAACATCAAGGCGCAGGTCGAGGCCGCGTGCAAGCAGACCGTCTCCTGCGCC
GACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCC
TTGGGTGGGCCGTCATGGAGGGTTCTTCTCGGGAGGCGTGACTCGACGACGGCGAGCTTGGCGCTGGCGAACAGCGACCTG
CCACCTCCGTCCTTCGACGTCGCCAACCTCACCGCCTCGTTCGCCGCCAAGGGGCTGAGCCAAGCCGACATGGTGGCGCTCTCCGGCGCGCACACGGTCGGGCAGGCGCAGTGCCAAAAC
TTCCGCGACAGGCTCTACAACGAGACCAACATCGACGCCGCCTTCGCGGCGGCGCTCAAGGCCAGCTGCCCGCGGCCGACGGGCAGCGGCGACGGCAACCTGGCGCCGCTGGACACGACG
ACGCCCACCGCGTTCGACAACGCCTACTACACCAACCTGCTGTCGAACAAGGGGCTCCTGCACTCCGACCAGGTGCTCTTCAACGGCGGCGCCGTCGACGGCCAGGTCCGGTCGTACGCG
TCCGGGCCGTCGAGGTTCAGAAGGGACTTCGCGGCGGCCATGGTGAAGATGGGGAACATCGCCCCGTTGACGGGAACGCAGGGACAAATCAGGCTCGTCTGCTCCAAGGTGAATTAA

Retrieve as FASTA