Entry information : PindGPx01
Entry ID 11194
Creation 2012-07-13 (Christophe Dunand)
Last sequence changes 2012-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-13 (Christophe Dunand)
Peroxidase information: PindGPx01
Name PindGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sebacinaceae Piriformospora
Organism Piriformospora indica    [TaxId: 65672 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PindGPx01
start..stop
S start..stop
SverGPx01 304 1e-107 1..181 1..185
XbadGPx01 278 1e-97 2..164 6..167
BeduGPx01 271 2e-93 4..164 90..249
WcoGPx01 266 5e-93 1..160 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2597..2620 24 N° 2 2672..2757 86 N° 3 2841..3059 219 N° 4 3113..3158 46
N° 5 3206..3376 171  
join(2597..2620,2672..2757,2841..3059,3113..3158,3206..3376)


exon

Literature and cross-references PindGPx01
DNA ref. GenBank:   CAFZ01000405.1 (2597..3376)
Protein sequence: PindGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181
PWM (Da):   %s   20002.07  
PI (pH):   %s   6.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTFYDLKAELPGKPEPYTFDQLKGKVVLIVNTASQCGFTPQYKGLETLYEKYKDRGFVILGFPSNQFGGQEPGTDEDIATFCELNHGVTFPLMKKSDVNGDNTNEVYQWLKKEKSGLLGMSRIWNFEKFLIDQNGKVVHRWASTTTPSSIEPHVEKLLAQTPTATTTAEPAAPAATTSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCACTTTTTACGATCTCAAGGTTGGTTTTAACCTGCGACTGGAATGACGTTGATATTCACCCTATTTCCAGGCAGAGCTCCCGGGTAAGCCGGAGCCCTATACGTTTGACCAGCTC
AAGGGCAAGGTTGTCCTCATTGTCAACACGGCCTCTCAATG
GTATGTATACTTACTCGTCGTAGGAATTTACTCACATTTTTCCCCCTCTTCTCCGATACCACCCACGTCATCTCCGACT
GCAGCGGGTTTACACCGCAATACAAGGGTCTCGAGACGCTCTATGAAAAGTACAAGGACCGTGGATTCGTCATTCTTGGATTCCCATCGAATCAATTTGGCGGACAAGAGCCCGGAACGG
ATGAGGATATTGCCACTTTTTGCGAGCTCAACCATGGAGTCACGTTTCCATTGATGAAGAAGAGTGACGTGAATGGAGATAACACCAACGAGGTTTACCAATG
GTATGTCTATCTCCCAT
CCAGCAAGGCCGTATACTAATGGGACGGCTGGGCAGGTTGAAAAAGGAAAAATCTGGACTGCTTGGAATGTCCCGAATCAAGGTAAGGATATTCATACATCTATATCCGATATATGCTGA
CGCGAGTAGTGGAACTTTGAGAAATTCCTGATCGACCAAAACGGCAAAGTAGTCCACCGATGGGCTTCGACGACGACTCCAAGCTCCATTGAGCCACATGTTGAGAAACTGCTGGCGCAG
ACTCCAACGGCGACGACGACCGCAGAGCCCGCGGCTCCAGCTGCCACTACCTCGTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCACTTTTTACGATCTCAAGGCAGAGCTCCCGGGTAAGCCGGAGCCCTATACGTTTGACCAGCTCAAGGGCAAGGTTGTCCTCATTGTCAACACGGCCTCTCAATGCGGGTTTACA
CCGCAATACAAGGGTCTCGAGACGCTCTATGAAAAGTACAAGGACCGTGGATTCGTCATTCTTGGATTCCCATCGAATCAATTTGGCGGACAAGAGCCCGGAACGGATGAGGATATTGCC
ACTTTTTGCGAGCTCAACCATGGAGTCACGTTTCCATTGATGAAGAAGAGTGACGTGAATGGAGATAACACCAACGAGGTTTACCAATG
GTTGAAAAAGGAAAAATCTGGACTGCTTGGA
ATGTCCCGAATCAAG
TGGAACTTTGAGAAATTCCTGATCGACCAAAACGGCAAAGTAGTCCACCGATGGGCTTCGACGACGACTCCAAGCTCCATTGAGCCACATGTTGAGAAACTGCTG
GCGCAGACTCCAACGGCGACGACGACCGCAGAGCCCGCGGCTCCAGCTGCCACTACCTCGTCATGA

Retrieve as FASTA