Entry information : CgaGPx02
Entry ID 11195
Creation 2012-07-13 (Christophe Dunand)
Last sequence changes 2012-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-13 (Christophe Dunand)
Peroxidase information: CgaGPx02
Name CgaGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Cryptococcus gattii (Filobasidiella gattii)    [TaxId: 292817 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgaGPx02
start..stop
S start..stop
CnGPx02_JEC21 361 4e-130 1..185 1..185
CnGPx02_grubiiH99 360 1e-129 1..185 1..185
DcryGPx02 281 3e-98 11..185 7..183
DcryGPx03 280 5e-98 11..185 7..183
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140137..140259 123 N° 2 140024..140073 50 N° 3 139814..139955 142 N° 4 139586..139722 137
N° 5 139402..139510 109  
complement(join(139402..139510,139586..139722,139814..139955,140024..140073,1401 37..140259))


exon

Literature and cross-references CgaGPx02
Protein ref. UniProtKB:   E6R6F6
DNA ref. GenBank:   CP000290.1 (140259..139402)
Protein sequence: CgaGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   186
PWM (Da):   %s   20289.26  
PI (pH):   %s   8.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFFDSIASKFGYESIPADVANKSFYDLKAKLPGNKGDLDFSTLKGKAVLIVNTASKCGFTPQYNGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCLNHGVTFPLMKKSEVNGKNMNEVFAWLKSQRGEHVGGVAGTTAIKWNFTKFLIDKEGRCVGRYGSSTKPEKLKDEIEKLLA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo E, 4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTTTTTCGACAGCATCGCTTCCAAGTTCGGTTATGAATCCATCCCGGCAGACGTTGCCAACAAGAGCTTCTATGATTTGAAAGCCAAATTGCCCGGGAACAAGGGTGACCTGGAC
TTT
GTGCGTGCTCTTTTTTATCATACCATCTAGATAAGGGAATAAGTGCTGACAGAACATATGCAGTCCACTTTGAAAGGCAAGGCTGTCTTGATCGTCAACACTGCTTCCAAATGGCAA
GTCTTTCGCTTTATTAACATGCATTAAAACAAATATAAGAACTGACTTGTATTTTGATGTGTAGTGGTTTCACTCCTCAGTACAACGGTCTTGAAGAGCTTCACAAGACTTACGGGGACA
AGGGTCTTGTTGTCCTCGGTTTCCCTTCCAACGAATTTGGAGGACAAGAGCCTGGCTCTGATGATGATATCGCCCAATTTTGTACC
GTGAGTCACCAGTCATTTATCCCGCCACACATCT
TGTGTTCGACGTATGGGCCAGAGGGATAGTGGCTGACATCGGATTAATATTTATTAGCTCAACCATGGCGTCACTTTCCCTCTTATGAAGAAGTCCGAAGTGAACGGGAAGAACATGAAC
GAGGTCTTTGCCTGGTTGAAGTCTCAGAGGGGAGAGCATGTTGGCGGTGTTGCCGGGACCACTGCTATCAAGTG
GTACGTTCCCTTTTTCATGAACTTCAGATGCATAATGTTATATCAG
TCAGAGCTGACATCCGATCATTTGTATAGGAACTTTACCAAATTCCTTATCGACAAGGAGGGCAGATGTGTTGGCCGATATGGCTCTTCCACTAAGCCAGAGAAGCTCAAGGACGAAATC
GAGAAGCTTCTCGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTTTTTCGACAGCATCGCTTCCAAGTTCGGTTATGAATCCATCCCGGCAGACGTTGCCAACAAGAGCTTCTATGATTTGAAAGCCAAATTGCCCGGGAACAAGGGTGACCTGGAC
TTT
TCCACTTTGAAAGGCAAGGCTGTCTTGATCGTCAACACTGCTTCCAAATGTGGTTTCACTCCTCAGTACAACGGTCTTGAAGAGCTTCACAAGACTTACGGGGACAAGGGTCTTGTT
GTCCTCGGTTTCCCTTCCAACGAATTTGGAGGACAAGAGCCTGGCTCTGATGATGATATCGCCCAATTTTGTACC
CTCAACCATGGCGTCACTTTCCCTCTTATGAAGAAGTCCGAAGTG
AACGGGAAGAACATGAACGAGGTCTTTGCCTGGTTGAAGTCTCAGAGGGGAGAGCATGTTGGCGGTGTTGCCGGGACCACTGCTATCAAGTG
GAACTTTACCAAATTCCTTATCGACAAG
GAGGGCAGATGTGTTGGCCGATATGGCTCTTCCACTAAGCCAGAGAAGCTCAAGGACGAAATCGAGAAGCTTCTCGCGTAA

Retrieve as FASTA