Entry information : UhorGPx01
Entry ID 11196
Creation 2012-07-13 (Christophe Dunand)
Last sequence changes 2012-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-13 (Christophe Dunand)
Peroxidase information: UhorGPx01
Name UhorGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Ustilago
Organism Ustilago hordei    [TaxId: 120017 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value UhorGPx01
start..stop
S start..stop
SreGPx 314 2e-112 1..161 1..161
UmGPx 310 1e-110 1..161 1..161
MresGPx01 226 1e-77 1..159 1..159
RsolGPx01 225 5e-77 1..159 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 60484..60735 252 N° 2 60819..60936 118 N° 3 61032..61147 116  
join(60484..60735,60819..60936,61032..61147)


exon

Literature and cross-references UhorGPx01
DNA ref. GenBank:   CAGI01000181.1 (60484..61147)
Protein sequence: UhorGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   161
PWM (Da):   %s   17973.04  
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVTFYDLKAKKPSQEEYTFDQLKGKVVLVVNTASKCGYTPQFAELEELNKKYGDQGLQIIGFPCNQFAGQDPENDDKIGEFCQRNYGVTFPMMAKSDVNGSNTNEVFAFLKKQRSGILGTEMIKWNFTKFLVDKQGNVIERYGSNTKPSAIAPTIEKLLAQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCACATTTTACGATCTCAAAGCCAAGAAGCCCTCTCAGGAGGAATACACCTTTGACCAGCTCAAGGGCAAGGTTGTTCTCGTCGTCAACACCGCTTCCAAGTGTGGTTACACTCCT
CAGTTTGCTGAGTTGGAAGAGTTGAACAAGAAGTATGGTGATCAGGGTTTGCAAATTATTGGTTTCCCTTGCAACCAGTTTGCAGGTCAGGATCCAGAGAACGATGACAAGATCGGAGAG
TTTTGCCAGCGT
GTAAGTTTGTTCGTCAAGTTAAAGGCTAATGTATGCCAAGGTTGCTGACAACGCCTTGTTGCATTGCACTCGTATATCGATAGAACTACGGTGTCACTTTCCCCATGA
TGGCCAAGTCGGACGTCAACGGATCCAACACCAACGAGGTGTTTGCTTTCCTTAAGAAGCAAAGGTCCGGCATCCTTGGCACCGAGATGATTA
GTACGTCATATTCACCCTTCTCTTCTC
GCAATCAGTTCGGCTTTATATACTAACGTTCTTGTCCTCTGCCTCCCCTCCGTCTCAACGCACCACAGAGTGGAACTTCACCAAGTTCCTCGTCGACAAGCAGGGCAACGTCATTGAGCG
CTACGGCTCCAACACCAAGCCTTCCGCCATTGCTCCTACCATCGAGAAGCTCCTCGCCCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCACATTTTACGATCTCAAAGCCAAGAAGCCCTCTCAGGAGGAATACACCTTTGACCAGCTCAAGGGCAAGGTTGTTCTCGTCGTCAACACCGCTTCCAAGTGTGGTTACACTCCT
CAGTTTGCTGAGTTGGAAGAGTTGAACAAGAAGTATGGTGATCAGGGTTTGCAAATTATTGGTTTCCCTTGCAACCAGTTTGCAGGTCAGGATCCAGAGAACGATGACAAGATCGGAGAG
TTTTGCCAGCGT
AACTACGGTGTCACTTTCCCCATGATGGCCAAGTCGGACGTCAACGGATCCAACACCAACGAGGTGTTTGCTTTCCTTAAGAAGCAAAGGTCCGGCATCCTTGGCACC
GAGATGATTA
AGTGGAACTTCACCAAGTTCCTCGTCGACAAGCAGGGCAACGTCATTGAGCGCTACGGCTCCAACACCAAGCCTTCCGCCATTGCTCCTACCATCGAGAAGCTCCTCGCC
CAGTAA

Retrieve as FASTA